Loading...
VII.1. Approvals for a Planned Unit Development and Conditional Use Permit at Cassia Chapel View Care Center – 412 5th Ave. N.; Krzos CITY OF HOPKINS City Council Report 2023-103 To: Honorable Mayor and Council Members Mike Mornson, City Manager From: Ryan Krzos, City Planner Date: October 3, 2023 Subject: 412 - 5th Ave N – Cassia Chapel View Care Center - Planned Unit Development and Conditional Use Permit _____________________________________________________________________ RECOMMENDED ACTION MOTIONS TO: Adopt Resolution 2023-033, approving a First Reading of the PUD Overlay Rezoning Ordinance and granting PUD Site Plan approval for 412 - 5th Ave N. Adopt Resolution 2023-034, approving a Conditional Use Permit allowing an 88-bed Skilled Nursing Facility at 412 - 5th Ave N. OVERVIEW Augustana Land Development LLC. requests land use approvals to allow a redevelopment of the former Mizpah Church at 412 - 5th Avenue North. The two-story development is for a new 88-bed skilled nursing facility adjacent to their existing Chapel View campus. A conditional use permit is required for this type of use. The proposed location is a 2.37-acre parcel with a vacated church. The new development proposal would include demolishing the church building. The applicant is also seeking the planned unit development (PUD) form of approval to facilitate the redevelopment. The Planning and Zoning Commission held a public hearing on this item at their September 26, 2023 meeting. Staff and the Planning and Zoning Commission recommend approval of the requests. PRIMARY ISSUES TO CONSIDER •Background •Legal Authority •Zoning Review •Alternatives SUPPORTING INFORMATION •Resolutions 2023-033 & 2023-034 •Owner’s Application, Narrative, Plans and Exhibits Planning & Development BACKGROUND The subject property at 412 - 5th Avenue North is zoned NX2, General Residential Mixed and is the location of the former Mizpah United Church of Christ facility. The existing church building was constructed in the 1950s with additions in the 1960s and 1980s. Day care businesses have also operated in the building. Augustana Land Development LLC recently purchased the property and is proposing to demolish the church building and construct a two-story 88-bed skilled nursing facility. The property owner operates the Chapel View campus adjacent to the site to the southwest. The owner indicates that the skilled nursing units in an existing building would be relocated to the new building. Facilities within that existing skilled nursing unit building, including a chapel, kitchen, and mechanical equipment, would remain to serve the entire campus despite the building no longer having residents. Future redevelopment of that building could occur and would need City land use approvals. The property owner also owns 6 of the 8 dwellings along the west side of 5th Avenue to the south of the site. None of those properties are part of this project, and they are guided by the Comprehensive Plan to remain generally same; at low to medium residential density (5-12 units per acre). Skilled nursing facilities are within the group living category as defined by the Zoning Code. Other group living uses include convents, dormitories, monasteries, fraternity and sorority houses, rooming houses, and residential facilities. Group living uses in the NX2 zone are a conditional use, meaning a conditional use permit must be granted by the City to initiate the use at a particular location. The applicant is also seeking the PUD form of approval which allows departures from the underlying zoning requirements in exchange for a development that exceeds minimum standards and quality. Because the proposed building is for a very specific population, the design of the building addresses different functional needs than if it was for the general population, particularly in the area of parking and circulation. A PUD allows for the flexibility to design parking that meets the needs of guests and employees rather than the occupants. Additionally, the subject lot has significant depth in relation to its width. As such, flexibility for building layout standards allows for more efficient use of the site’s developable area. PUBLIC COMMENT These planned unit development and conditional use applications require the applicant to host a neighborhood meeting. The intent of the neighborhood meeting is to expand and enhance the dissemination of information to the residents of the City and to encourage involvement by residents in the planning process. The meeting was held on Monday, September 11, 2023, at Gethsemane Lutheran Church. A summary of the meeting is included as an attachment. The land use approval requests also require a public hearing. The Planning and Zoning Commission held the public hearing at their September 26, 2023 meeting. The City published notice of the public hearing in the official paper and mailed notices directly to the properties and residents within 500 feet of the subject property. Signage informing the community of a pending development proposal was also displayed on the site. The City did not receive any written comments or calls on this item. During the public hearing, two members of the public spoke. One speaker indicated concerns about the prospect of vacant residential units, the other speaker expressed concerns about a tenant of a property owned by the applicant. Following the public hearing, the Planning and Zoning Commission discussed the proposal and the comments made by the speakers. Following discussion, the Planning and Zoning Commission approved a resolution recommending that the City Council approve the planned unit development request with the added stipulation that the applicant provides information to the Council on its position on corporate accountability, resolution of complaints and corporate responsibility. The applicant’s statement to that effect is included as an attachment to this report. The Commission also unanimously approved a resolution recommending that the City Council approve the requested conditional use permit. LEGAL AUTHORITY This proposal includes two different types of land use applications. The planned unit development application is considered a legislative action. When considering a legislative action, the City is assigning zoning classifications or creating development standards to regulate the types of uses and/or structures. Under the law, the City has wide flexibility to create standards that will ensure the type of development it desires; however, these regulations must be reasonable and supported by a rational basis relating to promoting the public health, safety and welfare. Conversely, a conditional use permit request is considered a quasi-judicial action. For this type of application, the City is judging whether the applicable Zoning regulations and approval criteria are or will be followed. Generally, if the application meets these requirements they should be approved. The City may impose conditions as long as said conditions are reasonably related to the impacts of the use or structures in question. CONDITIONAL USE PERMIT REVIEW The NX2 zone allows for Group Living uses upon approval of a conditional use permit. New conditional use permits may only be granted if the City determines that: (1)The proposed conditional use is consistent with the comprehensive plan and the purposes of the development code; (2)The proposed conditional use complies with all applicable provisions of the development code; and (3)The proposed conditional use will not be injurious to the neighborhood or otherwise detrimental to the public welfare. Consistency with the Comprehensive Plan The subject property is guided as General Urban Neighborhood in the 2040 Comprehensive Plan. The General Urban Neighborhood is characterized by compact moderate to high density residential neighborhoods include a range of attached multiple family and apartment units of varying scale and height. Neighborhoods typically are designed around large blocks with internal street systems that provide good vehicle connections. Development in the General Urban Neighborhood is to consist of moderate to high density residential and accessory uses. Projects are expected to be well connected via transit and support adjacent Centers. Scale and height of development should be compatible with existing and planned character. The residential density prescribed in the 2040 Comprehensive Plan in the General Urban Neighborhood future land use designation is 5 to 40 units per acre. With 88 beds and a parcel size of 2.37 acres the density equates to 37 units per acre. The following goals and policies of the Comprehensive Plan are supported by the proposed development: Built Environment – Land Use •Support and strengthen the city’s residential areas with reinvestment and appropriate infill. •Encourage all developments to incorporate common spaces (interior or exterior) that help enhance the public realm and sense of community. Built Environment – Housing •Grow the supply of housing in Hopkins, particularly in targeted areas. •Support the development of moderate to high density housing in appropriate locations. •Maintain neighborhoods with a choice of quality housing options, including those meeting the needs of a variety of household types and life stages. •Use redevelopment opportunities to provide new housing choices for the community. Social Environment – Quality of Life •Support the vision of a community where everyone has access to the resources and opportunities needed to live healthy, active lives. Natural Environment – Sustainability and Natural Resources •Encourage sustainable practices in locating, designing, constructing, and maintaining development in the city. •Support site design that efficiently and sustainably uses space. •Support greener development patterns through stormwater management and landscaping of sites. •Increase the use of solar power and other renewable sources for city infrastructure, facilities, and operations and encourage residents and businesses to make renewable energy improvements. •Support the development and use of renewable energy sources in Hopkins, including solar, geothermal, biomass, and other alternatives. Consistency with the Development Code A detailed assessment of the proposed facility against the standards of the zoning code is available here. As noted, multiple aspects of the project conflict with code requirements. As a result, the applicant is requesting approval of the project under the planned unit development process – as further analyzed below. Should the City decide against granting the planned unit development form of approval then any conflicts with the code should be resolved in order to grant conditional use permit approval. Beyond the deviations from the code requested by the applicant, staff is recommending conditions of approval requiring modifications to comply with certain standards. Specifically, the recommended conditions would require the following actions: •Installation of 15 bicycle parking stalls near the north main entryway. This would include a modification to the requirement that would have otherwise required 13 of the 15 stalls to meet the long-term standards. •Provision of two electric vehicle charging stations, and provision of four additional EV-ready stalls. •Addition of a fence between the proposed building and the dwelling located to the south in compliance with the side and rear buffer standards. •Reduce the width of the driveway opening from 24 feet to 22 feet. •The applicant will need to demonstrate that the proposed outdoor generator cannot function inside or otherwise relocate the equipment inside. •Provide 15-foot clearance for the canopy over the vehicle circulation area (currently proposed at 14 feet). •Verification of the required architectural and design detail standards regarding: o 70% of all street facade upper story windows must be operable; o Windows shall be recessed with the glass a minimum of 2 inches from the facade surface material or adjacent trim. o Use of commercial grade quality doors, windows, and hardware o Shadow lines must delineate changes in materials with a thickness that is greater than 1.5 inches (Note: this would be applicable where brick transitions to fiber cement panels) o Fencing details for the refuse and equipment enclosures in accordance with screening standards Staff find that these modifications are relatively minor in nature, and incorporating said changes to the plans would not alter how the development would impact the neighborhood. Impact on the Surroundings No material negative impacts on the immediate area are expected because of the proposed redevelopment. A traffic study conducted by the City’s on-call traffic consultant suggests that the proposed development is expected to generate approximately 12 - a.m. and p.m. peak hour trips and 269 daily trips. Furthermore, vehicle traffic generated from the proposed use can be supported by the existing roadway network and no vehicular capacity improvements are expected to be needed. The scale and height of the building is consistent with its surroundings. Plantings and required buffer fencing (see Zoning Review) provide appropriate transition with adjoining property. The redevelopment is not likely to impede the logical and orderly development (or redevelopment) of the adjoining properties. PLANNED UNIT DEVELOPMENT REVIEW The purpose of a planned unit development is to allow flexibility from traditional development standards in return for a higher quality development. Typically, the City looks for an applicant to exceed other zoning standards, building code requirements or meet other goals of the Comprehensive Plan. In exchange for the flexibility offered by the planned unit development, the applicant is expected to detail how they intend to provide a higher quality development or meet other City goals. The Zoning Code establishes two types of Planned Unit Developments (PUDs): small- scale PUD and large-scale PUD. Small-scale PUDs are optional for projects 3 acres in area or more, and mandatory for projects above that threshold. Since the affected parcel is 2.37 acres in size, the small-scale PUD should apply. In general, small-scale PUDs are more tailored to development on a single lot; whereas, large-scale PUDs are to promote master-planned development of large parcels with a system of streets, blocks, and open spaces, and a mix of zones to create new, walkable neighborhoods. The PUD process includes approval of a PUD overlay rezoning, and a PUD site plan approval. The rezoning component of the process adopts an overlay zone that supplements the underlying base zone (in this case the NX2 zone). The detailed plans for building and site design for the subject property comprise the PUD site plan. The requested Planned Unit Development would authorize the applicant to deviate from the zoning regulations described in the table on the following page. The applicant is seeking this flexibility in exchange for installation of rooftop solar panels, creation of privately owned park-like space along the sidewalk frontage, and interior courtyards for residents with significant planted areas. Requested Planned Unit Development Deviations Zoning Category Zoning Requirement Requested Deviation Building Location 120-380(d)(1) Front Streetwall. 75% minimum 89.7% Parking & Accessory Structures 102-880(e)(9) Surface Parking Location. Rear Yard Proposed Parking on side and rear yard. Trash Recycling, Refuse Locations 102-350 (d)(1) Trash, recycling, and other refuse areas must be located inside the building with access doors off the rear or interior side facade. Refuse container area proposed exterior to the building. Bicycle Parking Minimum 102-920 (a) A minimum of 15. (1 stall per 6 beds) 90% of required minimum as long-term. A minimum of 6 bike parking spaces will be provided. 100% allowed as short-term. In making recommendations and decisions regarding approval of PUDs, the City must consider at least the following factors: a.Whether the proposed PUD development plan and zoning map amendment is consistent with the comprehensive plan and any other adopted plans for the subject area; b.Whether PUD development plan complies with the PUD overlay zone provisions of Section 102-440 of the Development Code; c.Whether the proposed development will result in public benefits that are greater than or at least equal to those that would have resulted from development under conventional zoning regulations; and d.Whether appropriate terms and conditions have been imposed on the approval to protect the interests of surrounding property owners and residents, existing and future residents of the PUD and the general public. Consistency with the Comprehensive Plan A finding that the project is consistent with the Comprehensive Plan is required for approval of the Planned Unit Development. As noted in the Conditional Use Permit review section above, the proposal is consistent with the density guidance and would not directly conflict with the goals or policies of the Comprehensive Plan from staff’s perspective. There are no other adopted plans applicable to the subject site. Consistency with the PUD Section of the Code This application is being pursued as a small-scale PUD. The provisions of Section 102- 440 related to small-scale PUDs primarily state that the development would not be accommodated under the otherwise applicable standards and that the public benefits are at least commensurate with the degree of development flexibility granted and are addressed. Staff finds that the proposal generally strikes a reasonable balance in providing flexibility in exchange for a better overall project. The other provisions of this section pertain to the size and design of large-scale PUDs, which is not applicable. Balance of Benefits and Flexibility The applicant is seeking relief from the zoning provisions specified above. In general, staff finds that the requested deviations from the underlying standards are appropriately compensated for in the overall proposal. Protect Surroundings As noted in the conditional use permit review section, no material negative impacts on the immediate area are expected because of the proposed expansion. ALTERNATIVES 1. Approve the proposed land use requests. The City Council could consider applying additional or modified conditions of approval. 2. Deny the proposed land use requests. Should the City Council consider this option, it must also identify specific findings that support this alternative. 3. Continue for further information. If the City Council indicates that further information is needed, the item should be continued. 1 CITY OF HOPKINS HENNEPIN COUNTY, MINNESOTA ORDINANCE 2023-1202 AN ORDINANCE REZONING THE PROPERTY AT 412 – 5TH AVENUE NORTH (WITH PID 24-117-22-12-0008) FROM NX2, GENERAL RESIDENTIAL MIX TO NX2, GENERAL RESIDENTIAL MIX WITH A PLANNED UNIT DEVELOPMENT THE COUNCIL OF THE CITY OF HOPKINS DOES HEREBY ORDAIN AS FOLLOWS: 1.That the zoning classification of NX2, General Residential Mix, upon the following described premises is hereby repealed, and in lieu thereof, said premises is hereby zoned NX2, General Residential Mix with a Planned Unit Development (PUD). 2. The property to be rezoned is legally described in Exhibit A First Reading: October 3, 2023 Second Reading: October 10, 2023 Date of Publication: October 19, 2022 Date Ordinance Takes Effect: October 19, 2022 ________________________ ATTEST: Patrick Hanlon, Mayor __________________________ Amy Domeier, City Clerk 1 EXHIBIT A Legal Description of subject property Parcel 1: The North 45.22 feet of the following described property: All that part of the West one-half of the Northeast Quarter of Section 24, Township 117 North, Range 22 West of the Fifth Principal Meridian, described as follows, to-wit: Beginning on the East line of the Northwest Quarter of the Northeast Quarter of Section 24, Township 117, Range 22 at a point 1266.9 feet South of the Northeast corner of the Northwest Quarter of the North-East Quarter, thence South 554.7 feet to the North line of the Minnetonka Mills Road, thence Northwesterly along said line 531.92 feet, thence North and parallel with the East line of Northwest Quarter of the Northeast Quarter 340.4 feet, thence East 486.87 feet to the place of beginning, except the East 164 feet. Being Registered land as is evidenced by Certificate of Title No. 458162. Parcel 2: The South 200 feet of the North 1266.9 feet of the East 486.87 feet of the Northwest quarter of the Northeast quarter of Section 24, Township 117, Range 22. Being Registered land as is evidenced by Certificate of Title No. 166598. CITY OF HOPKINS Hennepin County, Minnesota RESOLUTION 2023-033 A RESOLUTION APPROVING A FIRST READING OF AN ORDINANCE REZONING THE PROPERTY AT 412 - 5TH AVENUE NORTH FROM NX2, GENERAL RESIDENTIAL MIX TO NX2 GENERAL RESIDENTIAL MIX WITH A PLANNED UNIT DEVELOPMENT, AND GRANTING PUD SITE PLAN APPROVAL, SUBJECT TO CONDITIONS WHEREAS, the applicant, Augustana Land Development LLC, initiated an application requesting to rezone the property at 412 - 5th Avenue North (PID 24-117-22-12-0008) from NX2, General Residential Mix to NX2, General Residential Mix with a Planned Unit Development (PUD) and requesting approval of a PUD site plan, and WHEREAS, this property is legally described in Exhibit A; and WHEREAS, the procedural history of the application is as follows: 1. That the above stated application was initiated by the applicant on August 25, 2023; and, 2.That the Hopkins Planning & Zoning Commission, pursuant to published and mailed notice, held a public hearing on the application and reviewed such application on September 26, 2023; all persons present were given an opportunity to be heard; and, 3.That the Hopkins Planning & Zoning Commission reviewed this application during their September 26, 2023 meeting and recommended approval by the City Council; and, 4.That written comments and analysis of City staff were considered; and, WHEREAS, staff recommended approval of the above stated application based on the findings outlined in Council Report 2023-103 dated October 3, 2023. NOW, THEREFORE, BE IT RESOLVED that the City Council of the City of Hopkins hereby approves a first reading of an ordinance rezoning the property at 412 - 5th Avenue from NX2, General Residential Mix to NX2, General Residential Mix with a Planned Unit Development (PUD) and hereby grants PUD site plan approval, subject to the conditions listed below. 1.Execution of a Planned Unit Development Agreement. 2.Approval of the associated conditional use permit to allow the proposed 88-bed Skilled Nursing Facility in the NX2, General Residential Mix zone and conformance with all related conditions. 3. Installation of two level 1 or level 2 electric vehicle charging stations, and provision of EV-ready capability in at least four additional stalls. 4. Installation of a minimum of 6 bicycle parking stalls near the north main entryway meeting the requirements for short-term parking. Note: this would include a PUD deviation to the requirement that would have otherwise required 15 bike parking stalls with 13 meeting the long-term standards. 5. Modification and resubmittal of site plans to show the addition of a fence between the proposed building and the dwelling located to the south in compliance with the side and rear buffer standards. 6. Modification and resubmittal of site plans to reduce the width of the driveway opening from 24 feet to 22 feet. 7. Modification of plans or verification that the horizontal shadow lines at the top of the ground story meet the requirement to be provide said shadow lines along 80% of the front façade. 8. Submittal of building plans that demonstrate compliance with the requirement that 70% of all street facade upper story windows are operable. 9. Submittal of building plans that demonstrate compliance with the requirement that windows are recessed with the glass a minimum of 2 inches from the facade surface material or adjacent trim. 10. Submittal of building plans that demonstrate compliance with the requirement that commercial grade quality doors, windows, and hardware are used. 11. Submittal of building plans that demonstrate compliance with the requirement that shadow lines delineate changes in materials with a thickness that is greater than 1.5 inches. 12. Submittal of building plans that provide fencing details for the refuse and equipment enclosures in accordance with screening standards per Section 102-8140 of the Zoning Code. 13. The applicant shall demonstrate that the proposed outdoor generator cannot function inside or shall be otherwise required to locate the equipment inside. 14. Approval of the development by the Minnehaha Creek Watershed District and conformance with all related conditions. 15. Payment of all applicable development fees including, but not limited to SAC, park dedication and City Attorney fees. Adopted this 3rd day of October, 2023. ________________________ ATTEST: Patrick Hanlon, Mayor __________________________ Amy Domeier, City Clerk EXHIBIT A Legal Description of subject property Parcel 1: The North 45.22 feet of the following described property: All that part of the West one-half of the Northeast Quarter of Section 24, Township 117 North, Range 22 West of the Fifth Principal Meridian, described as follows, to-wit: Beginning on the East line of the Northwest Quarter of the Northeast Quarter of Section 24, Township 117, Range 22 at a point 1266.9 feet South of the Northeast corner of the Northwest Quarter of the North-East Quarter, thence South 554.7 feet to the North line of the Minnetonka Mills Road, thence Northwesterly along said line 531.92 feet, thence North and parallel with the East line of Northwest Quarter of the Northeast Quarter 340.4 feet, thence East 486.87 feet to the place of beginning, except the East 164 feet. Being Registered land as is evidenced by Certificate of Title No. 458162. Parcel 2: The South 200 feet of the North 1266.9 feet of the East 486.87 feet of the Northwest quarter of the Northeast quarter of Section 24, Township 117, Range 22. Being Registered land as is evidenced by Certificate of Title No. 166598. CITY OF HOPKINS Hennepin County, Minnesota RESOLUTION 2023-034 A RESOLUTION APPROVING A CONDITIONAL USE PERMIT TO ALLOW AN 88-BED SKILLED NURSING FACILITY IN THE NX2 GENERAL RESIDENTIAL MIX ZONE ON THE PROPERTY AT 412 5TH AVENUE NORTH, SUBJECT TO CONDITIONS WHEREAS, the applicant, Augustana Land Development LLC, initiated an application for a conditional use permit to allow an 88-bed Skilled Nursing Facility on property in the NX2, General Residential Mix zone at 412 - 5th Avenue North, and; WHEREAS, this property is legally described in Exhibit A; and WHEREAS, the procedural history of the application is as follows: 1. That the above stated application was initiated by the applicant on August 25, 2023; and, 2. That the Hopkins Planning & Zoning Commission, pursuant to published and mailed notice, held a public hearing on the application and reviewed such application on September 26, 2023: all persons present were given an opportunity to be heard; and, 3. That the Hopkins Planning & Zoning Commission reviewed this application during their September 26, 2023 meeting and recommended approval by the City Council; and, 4. That written comments and analysis of City staff were considered; and, WHEREAS, staff recommended approval of the above stated application based on the findings in Council Report 2023-103 dated October 3, 2023. NOW, THEREFORE, BE IT RESOLVED that the City Council of the City of Hopkins hereby approves a conditional use permit to allow an 88-bed Skilled Nursing Facility in the NX2, General Residential Mix zone at 412 - 5th Avenue North, subject to the conditions listed below. 1. Conformance with all the general performance standards in Section 102-590 of the Hopkins Development Code. 2. Approval of the associated rezoning application and execution of a Planned Unit Development (PUD) Agreement. 3. Approval of the associated PUD site plan and conformance with all related conditions. 4. Approval of all necessary permits from the Building, Engineering and Fire Departments. 5. Approval of the development by the Minnehaha Creek Watershed District and conforms with all related conditions. 6. Payment of all applicable development fees including, but not limited to SAC, park dedication and City Attorney fees. Adopted this 3rd Day of October, 2023. ________________________ ATTEST: Patrick Hanlon, Mayor __________________________ Amy Domeier, City Clerk EXHIBIT A Legal Description of subject property Parcel 1: The North 45.22 feet of the following described property: All that part of the West one-half of the Northeast Quarter of Section 24, Township 117 North, Range 22 West of the Fifth Principal Meridian, described as follows, to-wit: Beginning on the East line of the Northwest Quarter of the Northeast Quarter of Section 24, Township 117, Range 22 at a point 1266.9 feet South of the Northeast corner of the Northwest Quarter of the North-East Quarter, thence South 554.7 feet to the North line of the Minnetonka Mills Road, thence Northwesterly along said line 531.92 feet, thence North and parallel with the East line of Northwest Quarter of the Northeast Quarter 340.4 feet, thence East 486.87 feet to the place of beginning, except the East 164 feet. Being Registered land as is evidenced by Certificate of Title No. 458162. Parcel 2: The South 200 feet of the North 1266.9 feet of the East 486.87 feet of the Northwest quarter of the Northeast quarter of Section 24, Township 117, Range 22. Being Registered land as is evidenced by Certificate of Title No. 166598. To: 9.28.23 Residents of the City of Hopkins City of Hopkins Planning and Zoning Staff and Commission City of Hopkins City Council I am writing this letter to you as a response to the City of Hopkins Planning and Zoning meeting that took place on September 26th, 2023. A current resident had put into question how we manage our residential properties along 5th Ave. and shared some of their experiences of Cassia’s response. This raised the question of how Cassia views corporate responsibility and how we operate among a predominantly residential community. It was also counter to the organizations position to be a good neighbor in all of our communities as promoted in the neighborhood meeting held on September 11th, 2023. As I have looked into the matters raised at the 9.26.23 Planning and Zoning Meeting, I have found that we as an organization have in fact continued to uphold every effort to be a good neighbor in the city of Hopkins based on the following; - We currently own 12 housing units along 5th Ave. and 1 housing unit on Minnetonka Mills Rd., all of which are currently occupied. - Of the thirteen units, just over half of them are rented to current or former employees, all of whom are in good standing - This rental opportunity allows for some of our staff to have affordable housing and a short commute to work - We do require background checks on all new tenants - We recently have done a background check audit, not related to this sequence of meetings, and have one on file for all current tenants with the exception of one. The one we are missing is from a current employee that remains in good standing. - Chapel View provides lawn care services and snow removal for the tenants at all of these locations - If there are repairs needed at any of the rental units, the tenants have access to an online repair request software. Once received our maintenance team can begin to address these items. - We do address complaints, internal and external, through the campus administrator. To date, it is our understanding that all complaints have been addressed with the exception of the most recent one that was sent on 9.20.23. This is still under review by our organization. It is our understanding that of all of the tenants that we provide housing to along 5th Ave. and Minnetonka Mills Rd., there is only one that has had public complaints made against them. Our site leaders have been actively working with the City of Hopkins Police Department and Fire Department when necessary to handle these situations at this one location. It should also be recalled that through the Covid pandemic that eviction was not allowed by both federal and state mandate. During that time our site leaders worked in concert with the city to address issues as best they could as that time was challenging for all. It is our confirmed belief that we have partnered well with the city and its supportive resources to address matters as best possible. Please know that we, as an organization, are actively pursuing all means to address this specific issue within our control at this time. I would like to also speak to another residents concern that was brought to the attention of the Planning Commission. Regarding our existing skilled nursing facility relocating to the new building on 5th Ave., and our operations vacating the existing facility on Minnetonka Mills. We do anticipate that that there will still be employee activity occurring within that building for the following reasons; - The existing care center houses major mechanical systems for the Chapel View Apartment building. - There is a full functioning kitchen that provides meals to the Chapel View Apartments. - There is a beautiful chapel that we cannot move to the old building. Although the skilled nursing residents and staff will not be in the rooms anymore, we anticipate the staff will still be in the halls and community space. We also anticipate that residents from the Chapel View Apartments will spread out a little bit more in the newly available space. We know that the grounds will need to be maintained as they currently are until a final plan is established for this location. On our current schedule, we know that this building will not be vacated any earlier than mid-year 2026. At that point we will have a better view of how the site may best be used to serve other lines of senior care and the Hopkins community. The request of the Planning and Zoning Commission on September 26th was to draft a position on how we approach Resolution of Complaints, Accountability of the properties we own, and Corporate Responsibility. We believe that through this review we do align with those values of the City of Hopkins. Resolutions of Complaints are managed through the campus administrator. If there is an issue, the conversation can start there and they have access to the resources of the organization if need be. We are accountable to the properties we own. That is modeled in the rental properties we are discussing as they allow staff to walk to work and have access to a maintenance issue program for their space to be cared for as needed. Additionally we have corporate reviewed contracts for lawn care and snow removal ensure that properties are addressed. We believe the most important component in this is the position of Corporate Responsibility. We do believe that it is of the greatest value to be one of the residents and neighbors of the cities we work in. This is true in every location within our portfolio regardless of the property size. In our skilled nursing and senior housing environments, this is often seen through our staff and the state and federal regulations that they are required to carry out. This plays out different when it comes to residential rental properties. We rely on our relationship with the renters, their relationship with their neighbors and their local communities. We recognize that these relationships will not always be perfect, and it is our corporate responsibility to address those issues when they arise. When needed, we do act. We act in partnership with the city and their resources. We act in partnership with the county and their resources as well. We exercise our organization and its network to accomplish these situations, but as we all know there is a process. I want to thank the City of Hopkins for the honor to have called Chapel View home since 1971. We are as excited today, forty two years later, to be here and serve this community as we were when it began. We are looking to continue the relationship with you as we know the need for senior care in this community is still great. We believe the new, state of the art, facility that we are proposing on the Mizpah Church property will be one that will serve residents well. We appreciate your time as we deepen the relationship within the community for decades to come. Sincerely, Andrew Centanni Cassia V.P. Building Design and Development AUGUST 25, 2023 Ryan Krzos Planner – Community Development 1010 1st St S Hopkins, MN 55343 rkrzos@hopkinsmn.com 7900 International Drive + Suite 550 + Bloomington, MN 55425 952.426.0699 + ISGInc.com Architecture + Engineering + Environmental + Planning RE: PROJECT NARRATIVE CASSIA CHAPEL VIEW HOMES - HOPKINS, MN Ryan, Thank you for reviewing the following PUD and Operational Narrative, along with the applications and plans for the Cassia Chapel View Care Center project. The site location is currently zoned NX-2, and we are requesting a PUD to allow for the potential variance on the following: Side Yard Parking, Exterior Trash Enclosure, and Building Frontage . Cassia will also consider the solar rooftop and pocket park on the east side in exchange. PROJECT DESCRIPTION Cassia is proposing to design a new skilled nursing facility located adjacent to their existing Chapel View campus on a 2.4 -acre parcel in Hopkins, MN. The new location is the current MIZPAH Church property. This new development will allow Cassia to relocate their current residents and staff to a brand new, state of the art, facility while continuing to serve the Hopkins community. The current nursing facility is a split-level with a maze of ramps and stairs creating significant barriers for residents to move independently throughout the place they call home. The new development proposed will be a true 2 -story facility with small basement. This will allow the residents to live within established neighborhoods and have independent access to day rooms, activity areas, and dining rooms without the requirement of staff assistance, ramps, gates, or elevators. The staff wi ll serve 88 residents, down only four from the current location. It is Cassia’s intent to have a ll of the estimated 170 current employees from the existing location relocate to the new building upon its completion and licensure. The proposed design paired with outstanding staff will make this project the location of choice for those needing these services in the west metro. Similar to the existing site, the new property will rely on outside services for operation including garbage, recycling, food , medical supplies, and oxygen. These services would continue to make the same number of trips throughout the week on the same schedule since the new delivery location is only a short distance, approximately 300’, from the currently operating facility. Like the current location along Minnetonka Blvd., the new location will operate 24 hours a day, 7 days a week. Unit Mixes 1st Floor • 40 – SC 1 rooms at 348 sf • 02 – SC 2 rooms at 565 sf 2nd Floor • 40 – SC 1 rooms at 348 sf • 02 – SC 2 rooms at 565 sf Parking Code Surface parking made up of 41 stalls that will be provided on site, as well as a pickup/drop off canopy for transit needs. Parking will be located on the North and South sides of the facility. The comfort and convenience of Cassia’s residents is of top priority, and close lobby access for transportation assistance is important. Page 2 of 3 952.426.0699 + ISGInc.com SITE FEATURE & AMENITIES The overall aesthetic of the site is to incorporate traditional architectural elements with an integrated landscape plan . This new community will house 80 private studio rooms and four shared units with private bedrooms, administrative spaces, nursing and care base stations, common gathering spaces, a central commercial kitchen with neighborhood dining halls, a community room, physical therapy and occupational therapy, up to four spas, barber/beauty space, storage, med rooms, as well as open circulation throughout the facility for ease of access to all spaces. The main level dining and gathering spaces will have immediate views and access to private courtyards. The courtyards will offer serene walking paths, gardens and areas of shade and rest. A pocket park with a meandering path and public benches will add a unique connection to the community as well as a place of restoration for those passing by, residents and visitors. The building roof will also provide solar panels to add a wonderful sustainability feature to this development. LANDSCAPING The overall landscape plan will offer many distinctive features including shade, color, structure, and screening. A traditional minimal maintenance planting plan consisting of native deciduous and evergreen plantings that will compliment architectural features and enhance new spaces. A tree inventory is provided documenting size and condition of existing site trees. Due to site alterations and plans a number of existing trees will need to be removed. A total of 49 in total. These include both significant and contributory trees. Total caliper inch of significant trees to be removed is equal to 547” caliper inches, while contributory trees is equal to 211” caliper in ches. This requires a caliper replacement of new trees equal to 1,851” caliper inches. The caliper replacement is above and beyond what is practical for the site. We will be looking to contribute to the City Tree Planting Fund with an agreed upon sum between all parties. 54 new site trees are proposed. 46 native deciduous trees at 2.5” calip er with 8 ornamental trees at a minimum of 6’ height. Site drainage and grading will consider overall site features (existing and proposed) ensuring all elements work together to create an effective drainage plan. Pervious pavement will be included in strategic areas across the site to aid in effective site drainage. A small infiltration basin will be used to capture water on site. Page 3 of 3 952.426.0699 + ISGInc.com Thank you for your consideration of this project. On behalf of Cassia, we look forward to collaborating with you on this development to aid Cassia with the relocation of their facility and for the ability to better serve the residents at Chapel View Care Center. Please contact me at 507.387.6651 or via email at Emily.Nepp@ISGInc.com with any questions or if there is any additional information we can provide in support of this project. Sincerely, Emily Nepp Development Services Coordinator Emily.Nepp@ISGInc.com 08/30/2023 NO PARKINGNO PARKING15 10 16 A3.2 2 A3.1 2 A3.1 1 A3.2 1 PROPOSED TWO-STORY SKILLED CARE W/ PARTIAL BASEMENT BUILDING 88 BEDS 0' NORTH 2010 40 SKILLED NURSING COURTYARD -SEE LANDSCAPE SKILLED NURSING COURTYARD -SEE LANDSCAPE 6' HIGH DECORATIVE FENCE AND GATE 6' HIGH DECORATIVE FENCE AND GATE NOTE: SEE CIVIL PLANS FOR SITE LAYOUT MONUMENT SIGN DELIVERY AREA TRASH & MECH EQUIP ENCLOSURE MAIN BUILDING ENTRY & DRIVE UNDER CANOPY PARKING LOT INFO - SEE CIVIL WOOD PERGOLA WOOD PERGOLA SETBACK 20'-0"SETBACK5'-0"PROPERTY LINE EASEMENT 5TH AVE NSEE CIVIL FOR EXISTING SITE & BUILDING DEMO BOLLARDS TRANSFORMER RETAINING WALL - SEE CIVIL SEE LANDSCAPE DRAWINGS 120'-0" 30'-0"199'-10"STREET ENTRANCE SOLAR PANELS FOR REFERENCE ONLY SOLAR PANELS FOR REFERENCE ONLY RETAINING WALL - SEE CIVIL D E S I G N G R O U P ISSUES & REVISIONS COMMISSION NO: DRAWN BY: CHECKED BY: SHEET 767 N. EUSTIS STREET, SUITE 190 ST. PAUL, MINNESOTA 55114 651.642.9200 WWW.POPEDESIGN.COM POPE DESIGN GROUP NOT FOR CONSTRUCTION0"1/2"1" TRUE SHEET SCALE DATE 8/25/2023 9:53:52 AM C:\Revit Projects\2023\11773-23069_Cassia Hopkins Pricing_R23_ALapacz_PDG.rvt A1.1 ARCHITECTURAL SITE PLAN AM AL 11773-23069 CASSIA CHAPEL VIEW CARE CENTER HOPKINS, MN 1" = 20'-0"A1.1 1 ARCHITECTURAL SITE PLAN 1 Addendum 1 07/14/2023 UPDWDNUPSTAIRTRASHHOLDINGMECHANICALELECTRICALELEVATORLAUNDRYDATAUNEXCAVATED63'-11"37'-6"25'-9"38'-4" 49'-0" 8'-11"RECEIVINGELEVATORSTAIRSTORAGEA3.22A3.12SC 1SC 1SC 1SC 1SC 1 SC 1 SC 1SC 1 SC 1SC 1SC 1SC 1SC 1SC 1SC 1SC 1SC 1SC 1SC 2SC 1SC 1TOILETSPALAUNDRYMEDSCLEANLINENHSKPSTAFFTLTOXYGENWELLNESS /TCU THERAPY& STORAGECONFERENCEROOMCHARTINGMULTI-PURPOSEROOMACTIVITYKITCHENCOMMERCIALKITCHENLIVING ROOMCARECONFERENCELIFT STORAGEELECMECHFAMILYLOUNGEDININGSOILEDLINENHALLA3.11A3.21A2.201DININGSTAIR BELEVATORSC 1 SC 1 SC 1 SC 1SC 1SC 1SC 1 SC 1 SC 2SC 1SC 1SC 1SC 1SC 1STAIR ASC 1SC 1SPATOILET LAUNDRYSOILEDLINENSC 1SC 1SC 1SC 1SC 1STAFFTLTOXYGENMEDSHSKP DATAELECMECHLIFTSTORAGECARECONFERENCECLEANLINENLIVING ROOMSTAIR CMULTI-PURPOSEROOMACTIVITYKITCHENA2.202STORAGE STORAGESTORAGESTORAGEMECHMECHWORKROOMOFFICEOFFICEOFFICELOBBYPARCELSTORAGERECEIVINGVESTIBULECASSIACAFE1A5.1116'-8"SEE SITE PLANSEE SITE PLANOFFICERECEPTCARTSTORAGESUNDRIESSTORAGEDATAPT TOILETSTAFF TLTTHERAPYKITCHENWDTHERAPYOFFICEPRIVATETHERAPY1 HR SMOKE BARRIER1 HR SMOKE BARRIER1 HR SMOKE BARRIER1 HR SMOKE BARRIERSMOKE COMPARTMENT SMOKE COMPARTMENT SMOKE COMPARTMENTSKILLED NURSING BUILDING (I-2)397'-4"60'-1" 106'-7" 64'-0" 106'-7"ELEVATOR2A5.131'-4"29'-8"87'-1"150'-9" 35'-6" 56'-3" 154'-10"TYP.8'-2" CLR.TYP.8'-2" CLR.17'-4"TLTTLTOFFICEFAMILYLOUNGECHARTINGOFFICESTORAGECANOPYENTRANCE VESTIBULE62'-3"D E S I G NG R O U PISSUES & REVISIONSCOMMISSION NO:DRAWN BY:CHECKED BY:SHEET767 N. EUSTIS STREET, SUITE 190ST. PAUL, MINNESOTA 55114651.642.9200WWW.POPEDESIGN.COMPOPE DESIGN GROUPNOT FOR CONSTRUCTION0"1/2"1"TRUE SHEET SCALEDATE8/24/2023 8:45:03 PMC:\Revit Projects\2023\11773-23069_Cassia Hopkins Pricing_R23_ALapacz_PDG.rvtA2.1LOWER LEVEL &FIRST FLOORPLANSAMAL11773-23069CASSIACHAPEL VIEWCARE CENTERHOPKINS, MN1/16" = 1'-0"A2.11LOWER LEVEL FLOOR PLAN0'NORTH2010400'NORTH2010401/16" = 1'-0"A2.12FIRST FLOOR PLAN2 A3.22A3.12A3.11A3.211A5.1ELEVATORSC 1SC 1TOILETSPALAUNDRYSOILEDLINENMECHSC 1SC 1SC 1STAIR BSC 2SC 1SC 1LIVING ROOMSC 1SC 1SC 1SC 1SC 1SC 1SC 1 SC 1MEDSCLEANLINENHSKPSTAFFTLTOXYGENCARECONFERENCELIFTSTORAGEEXAM ELECMECHDATASTORAGESC 1 SC 1 SC 1SC 1 SC 1MULTI-PURPOSEROOMACTIVITYKITCHENDINING DININGSTAIR CCHAMPLINCHARTINGSC 1SC 1SC 1SC 1SC 1 SC 1 SC 1SC 1SC 2SC 1SC 1SC 1SC 1SC 1SC 1SC 1TOILETSPALAUNDRYLIVING ROOMSOILEDLINENSTAIR AMECHMEDSCLEANLINENHSKPOXYGENCARECONFERENCELIFTSTORAGESTORAGEELECMECHDATASTORAGESC 1SC 1SC 1 SC 1SC 1MULTI-PURPOSEROOMACTIVITYKITCHENCOMMUNITYROOMHALLHOUSEHOLDKITCHEN /PANTRYBARBER /BEAUTYOFFICEOFFICEOFFICESTAFF BREAKROOMMOTHERSROOMRR/LOCKERSOFFICEROOF BELOW397'-4"116'-8"1 HR SMOKE BARRIER1 HR SMOKE BARRIER1 HR SMOKE BARRIER1 HR SMOKE BARRIER2A5.1ROOF ACCESS FROM STAIRS59'-11" 106'-6" 64'-2" 106'-6"8'-2"8'-2"A2.201A2.202TLTTLTOFFICECHARTINGOFFICEOFFICE62'-0"A3.22A3.12A3.11A3.211A5.1ROOF BELOWROOF BELOWROOF BELOWROOF ACCESS FROM STAIRS2" / 12"FLAT ROOFFLAT ROOF2A5.1SOLAR PANELS AS DESIGNED BY LICENSED INSTALLER / COVERAGE AS REQUIREDSOLAR PANELS AS DESIGNED BY LICENSED INSTALLER / COVERAGE AS REQUIREDDESI GNGROUPISSUES & REVISIONSCOMMISSION NO:DRAWN BY:CHECKED BY:SHEET767 N. EUSTIS STREET, SUITE 190ST. PAUL, MINNESOTA 55114651.642.9200WWW.POPEDESIGN.COMPOPE DESIGN GROUPNOT FOR CONSTRUCTION0"1/2"1"TRUE SHEET SCALEDATE8/24/2023 8:45:09 PMC:\Revit Projects\2023\11773-23069_Cassia Hopkins Pricing_R23_ALapacz_PDG.rvtA2.2SECOND LEVELFLOOR PLAN &ROOF PLANAMAL11773-23069CASSIACHAPEL VIEWCARE CENTERHOPKINS, MN0'NORTH2010401/16" = 1'-0"A2.21SECOND LEVEL FLOOR PLAN1/16" = 1'-0"A2.22ROOF PLAN0'NORTH2010401Addendum 107/14/2023 FIRST LEVEL 100'-0" SECOND LEVEL 112'-0" TRUSS BEARING 121'-11 1/8" 1 A5.1 FACE BRICK FACE BRICK 2 FIBER CEMENT BOARD FIBER CEMENT BOARD 2 2 A5.1 MANUFACTURED STONE SILL ALUM DOOR SYSTEM FIBER CEMENT TRIM BOARD 88'-3" RETURN MAJOR MATERIALS = 65% BRICK 88'-3" TRANSPARENCY = 20% (GROUND STORY) 23% (SECOND FLOOR) FIRST LEVEL 100'-0" SECOND LEVEL 112'-0" TRUSS BEARING 121'-11 1/8" LOWER LEVEL 88'-4" 1 A5.1 2 A5.1 37'-0" 20'-3" RETURN OF MAJOR MATERIALS = 68% BRICK TRANSPARENCY = 18% (GROUND STORY) 21% (SECOND FLOOR) D E S I G N G R O U P ISSUES & REVISIONS COMMISSION NO: DRAWN BY: CHECKED BY: SHEET 767 N. EUSTIS STREET, SUITE 190 ST. PAUL, MINNESOTA 55114 651.642.9200 WWW.POPEDESIGN.COM POPE DESIGN GROUP NOT FOR CONSTRUCTION0"1/2"1" TRUE SHEET SCALE DATE 8/30/2023 3:29:00 PM C:\Revit Projects\2023\11773-23069_Cassia Hopkins Pricing_R23_ALapacz_PDG.rvt A3.1 EXTERIOR ELEVATIONS AM AL 11773-23069 CASSIA CHAPEL VIEW CARE CENTER HOPKINS, MN 1/16" = 1'-0"A3.1 1 EXTERIOR ELEVATION - NORTH EXTERIOR ELEVATION KEYNOTES 1/16" = 1'-0"A3.1 2 EXTERIOR ELEVATION - SOUTH 1 Addendum 1 07/14/2023 2 Exterior Updates 08/30/2023 FIRST LEVEL 100'-0" SECOND LEVEL 112'-0" TRUSS BEARING 121'-11 1/8" LOWER LEVEL 88'-4" TRANSPARENCY = 21% (GROUND STORY) 23% (SECOND FLOOR) FIRST LEVEL 100'-0" SECOND LEVEL 112'-0" TRUSS BEARING 121'-11 1/8" LOWER LEVEL 88'-4" FACE BRICK FIBER CEMENT BOARD 2 " / 1 2 " FACE BRICK 2 MANUFACTURED STONE SILL STREET ENTRANCE DECORATIVE RAIL FIBER CEMENT BOARD COLUMNS 2'-0"6'-0"SHADE STRUCTURE FOR BENCH TRANSPARENCY = 28% (GROUND STORY) 27% (SECOND FLOOR) FACE BRICK = 65% FIBER CEMENT BOARD 2 FACE BRICK 2 D E S I G N G R O U P ISSUES & REVISIONS COMMISSION NO: DRAWN BY: CHECKED BY: SHEET 767 N. EUSTIS STREET, SUITE 190 ST. PAUL, MINNESOTA 55114 651.642.9200 WWW.POPEDESIGN.COM POPE DESIGN GROUP NOT FOR CONSTRUCTION0"1/2"1" TRUE SHEET SCALE DATE 8/30/2023 3:29:03 PM C:\Revit Projects\2023\11773-23069_Cassia Hopkins Pricing_R23_ALapacz_PDG.rvt A3.2 EXTERIOR ELEVATIONS AM AL 11773-23069 CASSIA CHAPEL VIEW CARE CENTER HOPKINS, MN 1/8" = 1'-0"A3.2 2 EXTERIOR ELEVATION -WEST 1/8" = 1'-0"A3.2 1 EXTERIOR ELEVATION -EAST 1 Addendum 1 07/14/2023 2 Exterior Updates 08/30/2023 X X X XXXXXXXOHLOHLOH L OH L OHLOHLOHL OHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHL OHLOHLOHLX X IIII I I I I I I I I I I I IIIIIIIIIIIIIIIIIIIXXXXX GMEX CBRIM=937.13EX m area drainRIM=937.94EX MHRIM=940.79EX MHRIM=940.4120WATERMAIN EASEMENT PERDOCUMENT NO. 2755908Rosewood WestAugustana Care CorporationMonumentSignGethsemane Evangelical Lutheran Church The Augustana Home of MinneapolisSignStairs5th AVENUE NORTHWATERMAIN EASEMENT PERDOCUMENT NO. 27559083314,014 sq. ft.412 5th Avenue340.4 (deed)DRAINAGE & UTILITY EASEMENTPER DOC. NO. 693519 PROPERTY LINEPROPERTY LINE 5' BUILDING SETBACK25' BUILDING SETBACK5' BUILDING SETBACK20' BUILDING SETBACKR=939.00EX STM MHI=932.30 (" ) SUMP STRUCTURE FILLED TO RIM W/ WATERR=937.06EX SAN MHI=929.44 (8" VCP) NW FLOWS SOUTH TO BEND IN SUMPI=929.43 (8" RCP) S BEND AT CENTER OF SUMP FLOW LINEI=929.42 (8" VCP) SW FLOWS SWR=936.16EX STM MHI=930.30 (12" PVC) SWR=935.02EX ST MHI=924.37 (18" PVC) EI=924.50 (OTHER" OTHER) SUMP BEND AT CENTER OF SUMP FLOW LINEI=924.41 (18" PVC) SW FLOWS NE TO BEND IN SUMPR=934.64EX ST MHI=923.04 (12" PVC) WI=923.10 (OTHER" OTHER) SUMP SUMP INV 12" FROM MD1 PIPEI=923.50 (12" PVC) S PIPE UNDER LADDERI=928.48 (6" PVC) W>>>>>>>>>>>>>>>>STMSTM9386" EXISTING WATERMAIN14'±30' ±2'2'10'2.56'23.19'20'20'11.76'13.03'18' 3' 20'47.74'42.59'19.63'117.84'156.43'96.43'TITLESHEET29290 C2-EXISTINGPROJECT NO.FILE NAMEDRAWN BYDESIGNED BYREVIEWED BYORIGINAL ISSUE DATECLIENT PROJECT NO.BYDESCRIPTIONREVISION SCHEDULEDATEPROJECTWITHOUT PRIOR WRITTEN CONSENT.INC. AND MAY NOT BE USED, COPIED OR DUPLICATED THIS DOCUMENT IS THE PROPERTY OF I & S GROUP,DWG LOCATION: S:\PROJECTS\29000 PROJ\29200-29299\29290 CASSIA CHAPEL VIEW CARE CENTER-HOPKINS MN\29290 PRODUCTION FILES\29290 CIVIL 3D\PRODUCTION DWGS\29290 C2-EXISTING.DWG SAVED BY: KYLE.HANNIGAN C2-10EXISTING SITE &REMOVAL PLAN-08/25/23C2-10 EXISTING SITE & REMOVAL PLAN 300 29290 C2-1023-29290HOPKINSMINNESOTA 0SCALE IN FEET2040BJK/TMKBJK/TMKRASCASSIACHAPEL VIEWCARE CENTERLIC. NO.DATEPROFESSIONAL ENGINEER UNDER THE LAWS OF THESTATE OF MINNESOTA.I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSEDPRELIMINARY NOT FOR CONSTRUCTION PRELIMINARY NOT FOR CONSTRUCTION PLOT DATE: 8/25/2023 10:42 AM REESE A. SUDTELGTE54243NOTE:THE CLARITY OF THESE PLANS DEPENDUPON COLOR COPIES. IF THIS TEXT DOESNOT APPEAR IN COLOR, THIS IS NOT ANORIGINAL PLAN SET AND MAY RESULT INMISINTERPRETATION.REMOVAL LEGENDSYMBOLDESCRIPTIONREMOVE BITUMINOUSPAVEMENTREMOVE CONCRETE WALKDEMOLISH BUILDINGREMOVE LANDSCAPINGCONTRACTOR SHALL VERIFY EXISTING PAVEMENT SECTIONAND NOTIFY ENGINEER OF ANY DISCREPANCIES.PAVEMENT REMOVALS SHALL INCLUDE FULL DEPTHSAWCUT AND SECTION REMOVAL.REMOVE EXISTINGCONCRETE WALKS (TYP)REMOVE EXISTING LANDSCAPEPATHS, EQUIPMENT/STRUCTURES,FENCING, AND MULCH BED AREAS(TYP)REMOVE EXISTINGCONCRETE CURBING WITHINPROJECT LIMITS (TYP)REMOVE EXISTINGBITUMINOUS PAVEMENT(WHERE SHOWN)REMOVE EXISTING BUILDING,INCLUDING CONNECTED STAIRAND CANOPY STRUCTURES ANDFOUNDATIONSREMOVE EXISTINGSTORAGE BUILDINGREMOVE EXISTINGROCK BORDERREMOVE EXISTINGROCK BORDERREMOVE EXISTING FLAGPOLEAND FOOTINGREMOVE EXISTING CATCHBASIN(SEE GENERAL UTILITY NOTE)REMOVE EXISTINGMONUMENT SIGNREMOVE EXISTING SIGNREMOVE EXISTINGLIGHT POLEAND FOOTINGREMOVE EXISTINGLANDSCAPE PLANTER BOXESREMOVE EXISTING DECKSTRUCTURE AND FOUNDATIONGENERAL UTILITY NOTE:CONTRACTOR TO REMOVE ALL UNDERGROUND UTILITIESTO THE PROJECT DISTURBED LIMITS. STORM AND/ORSANITARY SEWER PIPING EXTENDING BEYOND THEPROJECT DISTURBED LIMITS SHALL BE CAPPED ANDABANDONED IN PLACE, OR AS REQUIRED BY THE CITY.REMOVE TREE (TYP)REMOVE PLANTERSREMOVE RETAINING WALLSAWCUT AND REMOVEBITUMINOUS PAVEMENTREMOVE PLAYGROUND EQUIPMENTREMOVE FENCEAND FOOTING (TYP)REMOVE AREA DRAINPROTECT EXISTINGHYDRANT11001101110211031084108510991098109710961095109410931092109110901089108810871086108310821081108010791078107610771075107410731071107210701069106810671066106510641042104610451044104310471048104910501051105510541053105210561057105810591060106110621063TREE SURVEY NOTE:REFER TO SHEET C5-31 TREE SURVEY FOR REMOVALAND REPLACEMENT DOCUMENTATION 1015PROPOSED BUILDINGFFE = 943.3842,881 SQ. FT.16XXXXXXXXXXXXXXXXXXXXXXXXXXXX X X X NO PARKINGNO PARKINGX X XXXXX GM20WATERMAIN EASEMENT PERDOCUMENT NO. 2755908Rosewood WestAugustana Care CorporationGethsemane Evangelical Lutheran Church The Augustana Home of MinneapolisStairs5th AVENUE NORTHWATERMAIN EASEMENT PERDOCUMENT NO. 275590833340.4 (deed)DRAINAGE & UTILITY EASEMENTPER DOC. NO. 693519 5' BUILDING SETBACK25' BUILDING SETBACK5' BUILDING SETBACK20' BUILDING SETBACK6" EXISTING WATERMAIN18.67'9' (TYP)23.13'18' 24' 6' 6'6'6'R1'R63'R57'R66'R63'R1'R17'R103'R1'R57'R5'R15'R9.2'R3'R3'R3'R5.33'R2'R2'R2'R2'R15'R9'R3'R5'R3'R3'R5'R5'R10'R5'R11'R3'R1'R3'R3'R10'R10'R3'R3'R7'R66'R70'R62'R66.05'R8'R4'ST-3ST-4ST-6ST-7ST-10ST-10AST-9ST-8ST-2ST-5ST-1R17'TITLESHEET29290 C3-SITEPROJECT NO.FILE NAMEDRAWN BYDESIGNED BYREVIEWED BYORIGINAL ISSUE DATECLIENT PROJECT NO.BYDESCRIPTIONREVISION SCHEDULEDATEPROJECTWITHOUT PRIOR WRITTEN CONSENT.INC. AND MAY NOT BE USED, COPIED OR DUPLICATED THIS DOCUMENT IS THE PROPERTY OF I & S GROUP,DWG LOCATION: S:\PROJECTS\29000 PROJ\29200-29299\29290 CASSIA CHAPEL VIEW CARE CENTER-HOPKINS MN\29290 PRODUCTION FILES\29290 CIVIL 3D\PRODUCTION DWGS\29290 C3-SITE.DWG SAVED BY: BILL.KARELS C3-10SITE PLAN-08/25/23C3-10 SITE PLAN 300 29290 C3-1023-29290HOPKINSMINNESOTA 0SCALE IN FEET2040BJK/TMKBJK/TMKRASCASSIACHAPEL VIEWCARE CENTERLIC. NO.DATEPROFESSIONAL ENGINEER UNDER THE LAWS OF THESTATE OF MINNESOTA.I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSEDPRELIMINARY NOT FOR CONSTRUCTION PRELIMINARY NOT FOR CONSTRUCTION PLOT DATE: 8/25/2023 10:42 AM REESE A. SUDTELGTE54243NOTE:THE CLARITY OF THESE PLANS DEPENDUPON COLOR COPIES. IF THIS TEXT DOESNOT APPEAR IN COLOR, THIS IS NOT ANORIGINAL PLAN SET AND MAY RESULT INMISINTERPRETATION.PAVEMENT LEGENDSYMBOLDESCRIPTIONBITUMINOUS PAVEMENTHEAVY DUTY BITUMINOUSPAVEMENTCONCRETE PAVEMENTHEAVY DUTY CONCRETEPAVEMENTCONCRETE WALKREVERSE PITCH CONCRETECURB AND GUTTERTYPE ZERO CURB ANDGUTTERPERMEABLE PAVERSCONCRETE BEAM CURBBITUMINOUS PAVEMENTB618 CURB ANDGUTTER (TYP)REVERSE PITCH CURB AND GUTTER (TYP)NO PARKINGSTRIPING (TYP)REFERENCE ACCESSIBLEPARKING AREA DETAIL4" WHITE SOLID STALLSTRIPING (TYP)TRASH ENCLOSUREMODULAR BLOCKRETAINING WALL (TYP)3' CURBTAPER (TYP)6' DECORATIVEFENCE (TYP)DIRECTIONAL ARROWSTRIPINGMONUMENT SIGNGENERATOR TYPE ZEROCURB AND GUTTER6' GATE (TYP)6' DECORATIVEFENCE (TYP)6' GATE (TYP)6' GATE (TYP)PERMEABLE PAVERSPERMEABLE PAVERSHEAVY DUTYBITUMINOUS PAVEMENTCURB RAMP3' CURBTAPER (TYP)6' WIDE CONCRETEWALK (TYP)SIGN POST INBOLLARD (TYP)RAMP INCONCRETE WALKBITUMINOUS PAVEMENTCONCRETE CURB AND GUTTER (TYP)1' CONCRETE BEAM CURBAT PERMEABLE PAVERS1' CONCRETE BEAM CURBAT PERMEABLE PAVERS1' CONCRETE BEAM CURBAT PERMEABLE PAVERSSITE SUMMARY%SITE/LOT AREA:103,371SF =2.53(AC)EXISTING IMPERVIOUS:79,169SF =1.72(AC)76.5PROPOSED IMPERVIOUS:62,124SF =1.45(AC)60PERVIOUS PAVERS15,237SF =0.35(AC)14TURN DOWN CONCRETECURB AT PARKING STALLS(TYP)PIPE BOLLARD WITH COVER (TYP)SITE FURNISHINGS(TYP)TRASH/RECYCLINGRECEPTICLETHICKENED CONCRETE CURB AT PERMEABLE PAVERSMODULAR BLOCKRETAINING WALL (TYP) 1015PROPOSED BUILDINGFFE = 943.3842,881 SQ. FT.16XXXXXXXXXXXXXXXXXXXXXXXXXXXX X X X NO PARKINGNO PARKINGX X XXXXX GM20WATERMAIN EASEMENT PERDOCUMENT NO. 2755908Rosewood WestAugustana Care CorporationGethsemane Evangelical Lutheran Church The Augustana Home of MinneapolisStairs5th AVENUE NORTHWATERMAIN EASEMENT PERDOCUMENT NO. 275590833340.4 (deed)DRAINAGE & UTILITY EASEMENTPER DOC. NO. 693519 5' BUILDING SETBACK25' BUILDING SETBACK5' BUILDING SETBACK20' BUILDING SETBACK6" EXISTING WATERMAINTITLESHEET29290 C3-SITEPROJECT NO.FILE NAMEDRAWN BYDESIGNED BYREVIEWED BYORIGINAL ISSUE DATECLIENT PROJECT NO.BYDESCRIPTIONREVISION SCHEDULEDATEPROJECTWITHOUT PRIOR WRITTEN CONSENT.INC. AND MAY NOT BE USED, COPIED OR DUPLICATED THIS DOCUMENT IS THE PROPERTY OF I & S GROUP,DWG LOCATION: S:\PROJECTS\29000 PROJ\29200-29299\29290 CASSIA CHAPEL VIEW CARE CENTER-HOPKINS MN\29290 PRODUCTION FILES\29290 CIVIL 3D\PRODUCTION DWGS\29290 C3-SITE.DWG SAVED BY: BILL.KARELS C3-11PICK-UP PLAN-08/25/23C3-11 PICK-UP PLAN 300 29290 C3-1123-29290HOPKINSMINNESOTA 0SCALE IN FEET2040BJK/TMKBJK/TMKRASCASSIACHAPEL VIEWCARE CENTERLIC. NO.DATEPROFESSIONAL ENGINEER UNDER THE LAWS OF THESTATE OF MINNESOTA.I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSEDPRELIMINARY NOT FOR CONSTRUCTION PRELIMINARY NOT FOR CONSTRUCTION PLOT DATE: 8/25/2023 10:43 AM REESE A. SUDTELGTE54243NOTE:THE CLARITY OF THESE PLANS DEPENDUPON COLOR COPIES. IF THIS TEXT DOESNOT APPEAR IN COLOR, THIS IS NOT ANORIGINAL PLAN SET AND MAY RESULT INMISINTERPRETATION. PROPOSED BUILDINGFFE = 943.3842,881 SQ. FT.XXXXXXXXXXXXXXXXXXXXXXXXXXXX X X X NO PARKINGNO PARKINGINFILTRATION BASINTOP = 937.50100-YR HWL = 937.50BOTTOM = 936.00OHLOHLOH L OH L OHLOHLOHL OHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHL OHLOHLOHLX X IIII I I I I I I I I I I I IIIIIIIIIIIIIIIIIIIXXXXX GMEX MHRIM=940.79EX MHRIM=940.4120WATERMAIN EASEMENT PERDOCUMENT NO. 2755908Rosewood WestAugustana Care CorporationGethsemane Evangelical Lutheran Church The Augustana Home of MinneapolisStairs5th AVENUE NORTHWATERMAIN EASEMENT PERDOCUMENT NO. 275590833340.4 (deed)DRAINAGE & UTILITY EASEMENTPER DOC. NO. 693519 PROPERTY LINEPROPERTY LINE 5' BUILDING SETBACK25' BUILDING SETBACK5' BUILDING SETBACK20' BUILDING SETBACKR=939.00EX STM MHI=932.30 (" ) SUMP STRUCTURE FILLED TO RIM W/ WATERR=937.06EX SAN MHI=929.44 (8" VCP) NW FLOWS SOUTH TO BEND IN SUMPI=929.43 (8" RCP) S BEND AT CENTER OF SUMP FLOW LINEI=929.42 (8" VCP) SW FLOWS SWR=936.16EX STM MHI=930.30 (12" PVC) SWR=934.64EX ST MHI=923.04 (12" PVC) WI=923.10 (OTHER" OTHER) SUMP SUMP INV 12" FROM MD1 PIPEI=923.50 (12" PVC) S PIPE UNDER LADDERI=928.48 (6" PVC) W>>>>>>>>>>>>>>>>STMSTM6" EXISTING WATERMAIN>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>II I II I ST-3R=941.74I=938.42 (6'') P-4I=938.21 (6'') P-3ST-4R=941.72I=939.04 (6'') P-4ST-6R=941.75I=933.23 (6'') P-7I=933.03 (6'') P-6ST-7R=941.76I=933.86 (6'') P-7ST-10T/C=939.66I=936.71 (12'') P-10ST-9T/C=939.96I=935.75 (12'') SUBDRAINI=935.75 (12'') P-9ST-10AR=940.56I=936.12 (12'') P-10I=935.92 (18'') ADS TOP MANIFOLDI=935.51 (24'') ADS INLET MANIFOLDST-5R=936.59I=930.79 (12'') P-8I=932.49 (6'') P-6I=928.79 (12'') P-5ST-8R=937.07I=932.69 (12'') P-9I=932.49 (12'') P-8ST-2R=936.53I=933.00 (10'') P-2ST-1T/C=936.42I=932.40 (12'') P-1P-9 153'x12" @ 2.00%P-10 30'x12" @ 2.00%ADS INLET MANIFOLDP-1 45'x12" @ 3.75%P-2 80'x10" @ 2.00%P-4 31'x6" @ 2.00%P-3 3 6 ' x 6 " @ 2 . 0 0 %P-8 85'x12" @ 2.00%P-7 31'x6" @ 2.00%P-6 27'x6" @ 2.00%P-5 40'x12" @ 2.00%ADS TOP MANIFOLDEX MHCONNECT TO EXISTING STRUCTURE:I=931.40 (10'') P-2EX MHCONNECT TO EXISTING STRUCTURE:I=930.70 (12'') P-1EX MHREPLACE EXISTING CASTING WITHNEENAH R-2501-CR=934.99CONNECT TO EXISTING STRUCTUREI=927.98 (12'') P-5I=931.80 (8'') SUBDRAINI=931.80 (8'') SUBDRAINSTORM DRAIN STRUCTURE SCHEDULESTRUCTURE NO.ST-1ST-2ST-3ST-4ST-5ST-6ST-7ST-8ST-9ST-10ST-10ASTRUCTURETYPECATCH BASIN (TYPE 1)DRAIN BASINDRAIN BASINDRAIN BASINDRAIN BASINDRAIN BASINDRAIN BASINDRAIN BASINCATCH BASIN (TYPE 1)CATCH BASIN (TYPE 1)MnDOT 4020STRUCTURESIZE (IN)36 x 2415 Ø8 Ø8 Ø15 Ø8 Ø8 Ø12 Ø36 x 2436 x 2448 ØSTRUCTUREMATERIALRCPVCPVCPVCPVCPVCPVCPVCRCRCRCCASTINGNEENAH R-3067-VBNYLOPLAST 1599CGDNYLOPLAST 0899CGDNYLOPLAST 0899CGDNYLOPLAST 1599CGCNYLOPLAST 0899CGDNYLOPLAST 0899CGDNYLOPLAST 1299CGCNEENAH R-3067-VBNEENAH R-3067-VBNEENAH R-1733 "STORM SEWER" IN COVERPAY HEIGHT(LN FT)4.024.034.853.186.309.228.405.084.212.958.05* TOP OF CASTINGELEVATION936.42936.53941.74941.72936.59941.75941.76937.07939.96939.66940.56SUMPELEVATION932.40932.50936.90938.54930.29932.53933.36931.99935.75936.71932.51SUMPDEPTH0.00'0.50'0.50'0.50'0.50'0.50'0.50'0.50'0.00'0.00'3.00'OUTLETINVERT932.40933.00938.21939.04928.79933.03933.86932.49935.75936.71935.51OUTLETPIPEP-1P-2P-3P-4P-5P-6P-7P-8P-9P-10ADS INLET MANIFOLDSTORM DRAIN PIPE SCHEDULEPIPENO.P-1P-2P-3P-4P-5P-6P-7P-8P-9P-10DRAINFROMST-1ST-2ST-3ST-4ST-5ST-6ST-7ST-8ST-9ST-10INLETELEVATION932.40933.00938.21939.04928.79933.03933.86932.49935.75936.71DRAINTOEX MHEX MHHEADWALLST-3EX MHST-5ST-6ST-5ST-8ST-10AOUTLETELEVATION930.70931.40937.50938.42927.98932.49933.23930.79932.69936.12PIPESIZE (IN)1210661266121212MATERIALPVCPVCPVCPVCPVCPVCPVCPVCPVCPVCPIPECLASSSCH 40SCH 40SCH 40SCH 40SCH 40SCH 40SCH 40SCH 40SCH 40SCH 40PIPEGRADE3.75%2.00%2.00%2.00%2.00%2.00%2.00%2.00%2.00%2.00%PIPELENGTH (FT)458036314027318515330* TOP OF CASTING ELEVATIONS ON CURB STYLE CATCH BASINS = FORM GRADE, NOT TOP BACK OF CURB BOX ELEVATIONTITLESHEET29290 C3-UTILITIESPROJECT NO.FILE NAMEDRAWN BYDESIGNED BYREVIEWED BYORIGINAL ISSUE DATECLIENT PROJECT NO.BYDESCRIPTIONREVISION SCHEDULEDATEPROJECTWITHOUT PRIOR WRITTEN CONSENT.INC. AND MAY NOT BE USED, COPIED OR DUPLICATED THIS DOCUMENT IS THE PROPERTY OF I & S GROUP,DWG LOCATION: S:\PROJECTS\29000 PROJ\29200-29299\29290 CASSIA CHAPEL VIEW CARE CENTER-HOPKINS MN\29290 PRODUCTION FILES\29290 CIVIL 3D\PRODUCTION DWGS\29290 C3-UTILITIES.DWG SAVED BY: BILL.KARELS C3-20UTILITY PLAN-08/25/23C3-20 UTILITY PLAN 300 29290 C3-2023-29290HOPKINSMINNESOTA 0SCALE IN FEET2040BJK/TMKBJK/TMKRASCASSIACHAPEL VIEWCARE CENTERLIC. NO.DATEPROFESSIONAL ENGINEER UNDER THE LAWS OF THESTATE OF MINNESOTA.I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSEDPRELIMINARY NOT FOR CONSTRUCTION PRELIMINARY NOT FOR CONSTRUCTION PLOT DATE: 8/25/2023 10:43 AM REESE A. SUDTELGTE54243NOTE:THE CLARITY OF THESE PLANS DEPENDUPON COLOR COPIES. IF THIS TEXT DOESNOT APPEAR IN COLOR, THIS IS NOT ANORIGINAL PLAN SET AND MAY RESULT INMISINTERPRETATION.UTILITY LEGENDEXISTINGPROPOSEDSTORM DRAINSANITARY SEWERSANITARY SEWER FORCEMAINWATER MAINGASOVERHEAD ELECTRICUNDERGROUND ELECTRICUNDERGROUND TELEPHONEUNDERGROUND TVOVERHEAD UTILITYUNDERGROUND UTILITYFIBER OPTICNOTE:CONTRACTOR SHALL FIELD VERIFY THE LOCATIONS OF ALL EXISTING UTILITIES.>>>>>><IIII>IIGGOEOEUEUEUTUTUTVOHLUTLFBOCONSTRUCT 8" SANITARY SERVICEWITHIN 5' OF BUILDING- CONTINUATION TO BUILDING BY MECHANICAL CONTRACTORCONSTRUCT 6" FIRE SERVICEAND 4" DOMESTIC WATER SERVICETO WITHIN 5' OFBUILDING - CONTINUATION TOBUILDING BYMECHANICAL CONTRACTORCONNECT - WET TAPAND INSTALL VALVEFOR BOTH SERVICES(FIELD VERIFY SIZEAND LOCATION)CONTRACTOR TOPROVIDE 18" MINVERTICAL SEPARATIONBETWEEN UTILITY PIPINGPROVIDE LEVEL 1 POND LINER BETWEEN PERMEABLEPAVER SECTION AND SOUTHERN CURB LINE.HDPE OR PVC LINER ARE ALLOWABLE. HDPE LINERMUST HAVE A MINIMUM THICKNESS OF 60 MILS.PVC POND LINER MUST HAVE A MINIMUM THICKNESS30 MILS. BOTTOM OF LINER SHOULD TERMINATE ATLEAST THREE FEET BELOW BOTTOM OF THE BMP.INSULATE SANITARY SERVICE(SEE DETAIL)6" SCH 40 SANITARYSERVICE @ 1.00% PROPOSED BUILDINGFFE = 943.3842,881 SQ. FT.XXXXXXXXXXXXXXXXXXXXXXXXXXXX X X X NO PARKINGNO PARKINGINFILTRATION BASINTOP = 937.50100-YR HWL = 937.50BOTTOM = 936.00OHLOHLOH L OH L OHLOHLOHL OHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHL OHLOHLOHLX X IIII I I I I I I I I I I I IIIIIIIIIIIIIIIIIIIXXXXX GMEX MHRIM=940.79EX MHRIM=940.4120WATERMAIN EASEMENT PERDOCUMENT NO. 2755908Rosewood WestAugustana Care CorporationGethsemane Evangelical Lutheran Church The Augustana Home of MinneapolisStairs5th AVENUE NORTHWATERMAIN EASEMENT PERDOCUMENT NO. 275590833340.4 (deed)DRAINAGE & UTILITY EASEMENTPER DOC. NO. 693519 PROPERTY LINEPROPERTY LINE 5' BUILDING SETBACK25' BUILDING SETBACK5' BUILDING SETBACK20' BUILDING SETBACKR=939.00EX STM MHI=932.30 (" ) SUMP STRUCTURE FILLED TO RIM W/ WATERR=937.06EX SAN MHI=929.44 (8" VCP) NW FLOWS SOUTH TO BEND IN SUMPI=929.43 (8" RCP) S BEND AT CENTER OF SUMP FLOW LINEI=929.42 (8" VCP) SW FLOWS SWR=936.16EX STM MHI=930.30 (12" PVC) SWR=934.64EX ST MHI=923.04 (12" PVC) WI=923.10 (OTHER" OTHER) SUMP SUMP INV 12" FROM MD1 PIPEI=923.50 (12" PVC) S PIPE UNDER LADDERI=928.48 (6" PVC) W>>>>>>>>>>>>>>>>STMSTM6" EXISTING WATERMAIN>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>II I II I TITLESHEET29290 C3-UTILITIESPROJECT NO.FILE NAMEDRAWN BYDESIGNED BYREVIEWED BYORIGINAL ISSUE DATECLIENT PROJECT NO.BYDESCRIPTIONREVISION SCHEDULEDATEPROJECTWITHOUT PRIOR WRITTEN CONSENT.INC. AND MAY NOT BE USED, COPIED OR DUPLICATED THIS DOCUMENT IS THE PROPERTY OF I & S GROUP,DWG LOCATION: S:\PROJECTS\29000 PROJ\29200-29299\29290 CASSIA CHAPEL VIEW CARE CENTER-HOPKINS MN\29290 PRODUCTION FILES\29290 CIVIL 3D\PRODUCTION DWGS\29290 C3-UTILITIES.DWG SAVED BY: BILL.KARELS C3-21HYDRANTCOVERAGE PLAN-08/25/23C3-21 HYDRANT COVERAGE PLAN 300 29290 C3-2123-29290HOPKINSMINNESOTA 0SCALE IN FEET2040BJK/TMKBJK/TMKRASCASSIACHAPEL VIEWCARE CENTERLIC. NO.DATEPROFESSIONAL ENGINEER UNDER THE LAWS OF THESTATE OF MINNESOTA.I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSEDPRELIMINARY NOT FOR CONSTRUCTION PRELIMINARY NOT FOR CONSTRUCTION PLOT DATE: 8/25/2023 10:43 AM REESE A. SUDTELGTE54243NOTE:THE CLARITY OF THESE PLANS DEPENDUPON COLOR COPIES. IF THIS TEXT DOESNOT APPEAR IN COLOR, THIS IS NOT ANORIGINAL PLAN SET AND MAY RESULT INMISINTERPRETATION.HYDRANT COVERAGE LEGENDEXISTING HYDRANTPROPOSED HYDRANTR250'R250' 1015PROPOSED BUILDINGFFE = 943.3842,881 SQ. FT.16XXXXXXXXXXXXXXXXXXXXXXXXXXXX X X X NO PARKINGNO PARKINGINFILTRATION BASINTOP = 937.50100-YR HWL = 937.50BOTTOM = 936.00OHLOHLOH L OH L OHLOHLOHL OHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHL OHLOHLOHLX X IIII I I I I I I I I I I I IIIIIIIIIIIIIIIIIIIXXXXX GMEX MHRIM=940.79EX MHRIM=940.4120WATERMAIN EASEMENT PERDOCUMENT NO. 2755908Rosewood WestAugustana Care CorporationGethsemane Evangelical Lutheran Church The Augustana Home of MinneapolisStairs5th AVENUE NORTHWATERMAIN EASEMENT PERDOCUMENT NO. 275590833340.4 (deed)DRAINAGE & UTILITY EASEMENTPER DOC. NO. 693519 PROPERTY LINEPROPERTY LINE935935 940945936937938939 941942943944946947935940940936937938 941942 940945945945939941 94194 1 941942942 943 943943944944944 >>>>>>>>>>>>>>>>938 >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>II I II I -4.2 %-2.0%- 1 . 8% -3 .1%-2.2%-1.2% -4. 1 %-2.1%-2.6% -1.2%-2.6%-7.2%-4.1%-4.8%-2.3%-2.4%-2.0%-2.7%-1.8% - 2 . 9% -1.7%-1.7%-4.4%-1.7% -1.5%941.80940.90941.84940.96940.39941.88941.88941.35940940940939 941941941 941941 941 9419429429429 4 2942942 942 94394394393793893693 6 9369369369 3 6 936936937940936 936937937 937938939941941941942ST-3R=941.74ST-4R=941.72ST-6R=941.75ST-7R=941.76ST-10AR=940.56ST-9R=939.96ST-10R=939.66ST-8R=937.07ST-2R=936.53ST-5R=936.59ST-1R=936.42EX MHR=0.66ST-79R=933.60TITLESHEET29290 C4-GRADINGPROJECT NO.FILE NAMEDRAWN BYDESIGNED BYREVIEWED BYORIGINAL ISSUE DATECLIENT PROJECT NO.BYDESCRIPTIONREVISION SCHEDULEDATEPROJECTWITHOUT PRIOR WRITTEN CONSENT.INC. AND MAY NOT BE USED, COPIED OR DUPLICATED THIS DOCUMENT IS THE PROPERTY OF I & S GROUP,DWG LOCATION: S:\PROJECTS\29000 PROJ\29200-29299\29290 CASSIA CHAPEL VIEW CARE CENTER-HOPKINS MN\29290 PRODUCTION FILES\29290 CIVIL 3D\PRODUCTION DWGS\29290 C4-GRADING.DWG SAVED BY: BILL.KARELS C4-10GRADING PLAN-08/25/23C4-10 GRADING PLAN 300 29290 C4-1023-29290HOPKINSMINNESOTA 0SCALE IN FEET2040BJK/TMKBJK/TMKRASCASSIACHAPEL VIEWCARE CENTERLIC. NO.DATEPROFESSIONAL ENGINEER UNDER THE LAWS OF THESTATE OF MINNESOTA.I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSEDPRELIMINARY NOT FOR CONSTRUCTION PRELIMINARY NOT FOR CONSTRUCTION PLOT DATE: 8/25/2023 10:44 AM REESE A. SUDTELGTE54243NOTE:THE CLARITY OF THESE PLANS DEPENDUPON COLOR COPIES. IF THIS TEXT DOESNOT APPEAR IN COLOR, THIS IS NOT ANORIGINAL PLAN SET AND MAY RESULT INMISINTERPRETATION.GRADING LEGENDEXISTING CONTOUR (MINOR INTERVAL)EXISTING CONTOUR (MAJOR INTERVAL)PROPOSED CONTOUR (MINOR INTERVAL)PROPOSED CONTOUR (MAJOR INTERVAL)EXISTING SPOT ELEVATIONPROPOSED SPOT ELEVATIONPROPOSED TOP BACK OF CURB SPOT ELEVATIONPROPOSED TOP OF RETAINING WALL (T/W) ANDBOTTOM OF RETAINING WALL (B/W)SURFACE GRADE / DIRECTIONGENERAL GRADING NOTESPROPOSED CONTOURS SHOW FINISHED GRADE ELEVATIONS. BUILDING PAD AND PAVEMENT HOLDDOWNS ARE NOT INCLUDED. WHEN CONSTRUCTING BUILDING PADS WITH A HOLD DOWN, GRADEAREAS TO ENSURE POSITIVE BUILDING PAD DRAINAGE.101100101100XXXX.XX X X X . X X X X X . X XXXX.XX T/WX X X . X X B / W-X.X%GENERATOR PADEL = 937.60 1015PROPOSED BUILDINGFFE = 943.3842,881 SQ. FT.16XXXXXXXXXXXXXXXXXXXXXXXXXXXX X X X NO PARKINGNO PARKINGINFILTRATION BASINTOP = 937.50100-YR HWL = 937.50BOTTOM = 936.00X X XXXXX GM20WATERMAIN EASEMENT PERDOCUMENT NO. 2755908Rosewood WestAugustana Care CorporationGethsemane Evangelical Lutheran Church The Augustana Home of MinneapolisStairs5th AVENUE NORTHWATERMAIN EASEMENT PERDOCUMENT NO. 275590833340.4 (deed)DRAINAGE & UTILITY EASEMENTPER DOC. NO. 693519 5' BUILDING SETBACK25' BUILDING SETBACK5' BUILDING SETBACK20' BUILDING SETBACK6" EXISTING WATERMAIN>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>II I II I MULCHQTYBOTANICAL / COMMON NAME10,661 SFDOUBLE SHREDDED HARDWOOD MULCHMULCH2,071 SFLANDSCAPE ROCK 3' DEPTHMULCHSEEDINGQTYBOTANICAL / COMMON NAME1,763 SFSEED MIXINFILTRATION BASIN MIXSODQTYBOTANICAL / COMMON NAME7,553 SFTURF SODDROUGHT TOLERANT FESCUE BLENDPLANT SCHEDULETITLESHEET29290 C5-LANDPROJECT NO.FILE NAMEDRAWN BYDESIGNED BYREVIEWED BYORIGINAL ISSUE DATECLIENT PROJECT NO.BYDESCRIPTIONREVISION SCHEDULEDATEPROJECTWITHOUT PRIOR WRITTEN CONSENT.INC. AND MAY NOT BE USED, COPIED OR DUPLICATED THIS DOCUMENT IS THE PROPERTY OF I & S GROUP,DWG LOCATION: S:\PROJECTS\29000 PROJ\29200-29299\29290 CASSIA CHAPEL VIEW CARE CENTER-HOPKINS MN\29290 PRODUCTION FILES\29290 CIVIL 3D\PRODUCTION DWGS\29290 C5-LAND.DWG SAVED BY: BILL.KARELS C5-10SITERESTORATIONPLAN-08/25/23C5-10 SITE RESTORATION PLAN 300 29290 C5-1023-29290HOPKINSMINNESOTA 0SCALE IN FEET2040BJK/TMKBJK/TMKRASCASSIACHAPEL VIEWCARE CENTERLIC. NO.DATEPROFESSIONAL ENGINEER UNDER THE LAWS OF THESTATE OF MINNESOTA.I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSEDPRELIMINARY NOT FOR CONSTRUCTION PRELIMINARY NOT FOR CONSTRUCTION PLOT DATE: 8/25/2023 10:44 AM REESE A. SUDTELGTE54243NOTE:THE CLARITY OF THESE PLANS DEPENDUPON COLOR COPIES. IF THIS TEXT DOESNOT APPEAR IN COLOR, THIS IS NOT ANORIGINAL PLAN SET AND MAY RESULT INMISINTERPRETATION.EDGING (TYP)LARGE FLAGSTONE STEPPERSEDGING (TYP)EDGING (TYP) 1015PROPOSED BUILDINGFFE = 943.3842,881 SQ. FT.16XXXXXXXXXXXXXXXXXXXXXXXXXXXX X X X NO PARKINGNO PARKINGINFILTRATION BASINTOP = 937.50100-YR HWL = 937.50BOTTOM = 936.00X X XXXXX GM20WATERMAIN EASEMENT PERDOCUMENT NO. 2755908Rosewood WestAugustana Care CorporationGethsemane Evangelical Lutheran Church The Augustana Home of MinneapolisStairs5th AVENUE NORTHWATERMAIN EASEMENT PERDOCUMENT NO. 275590833340.4 (deed)DRAINAGE & UTILITY EASEMENTPER DOC. NO. 693519 5' BUILDING SETBACK25' BUILDING SETBACK5' BUILDING SETBACK20' BUILDING SETBACK6" EXISTING WATERMAIN>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>II I II I TITLESHEET29290 C5-LANDPROJECT NO.FILE NAMEDRAWN BYDESIGNED BYREVIEWED BYORIGINAL ISSUE DATECLIENT PROJECT NO.BYDESCRIPTIONREVISION SCHEDULEDATEPROJECTWITHOUT PRIOR WRITTEN CONSENT.INC. AND MAY NOT BE USED, COPIED OR DUPLICATED THIS DOCUMENT IS THE PROPERTY OF I & S GROUP,DWG LOCATION: S:\PROJECTS\29000 PROJ\29200-29299\29290 CASSIA CHAPEL VIEW CARE CENTER-HOPKINS MN\29290 PRODUCTION FILES\29290 CIVIL 3D\PRODUCTION DWGS\29290 C5-LAND.DWG SAVED BY: BILL.KARELS C5-11SITE IRRIGATIONPLAN-08/25/23C5-11 SITE IRRIGATION PLAN 300 29290 C5-1123-29290HOPKINSMINNESOTA 0SCALE IN FEET2040BJK/TMKBJK/TMKRASCASSIACHAPEL VIEWCARE CENTERLIC. NO.DATEPROFESSIONAL ENGINEER UNDER THE LAWS OF THESTATE OF MINNESOTA.I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSEDPRELIMINARY NOT FOR CONSTRUCTION PRELIMINARY NOT FOR CONSTRUCTION PLOT DATE: 8/25/2023 10:44 AM REESE A. SUDTELGTE54243NOTE:THE CLARITY OF THESE PLANS DEPENDUPON COLOR COPIES. IF THIS TEXT DOESNOT APPEAR IN COLOR, THIS IS NOT ANORIGINAL PLAN SET AND MAY RESULT INMISINTERPRETATION.IRRIGATION LEGENDSYMBOLDESCRIPTIONDRIP IRRIGATIONROTOR IRRIGATION1.IRRIGATION CONTRACTOR SHALL BE RESPONSIBLE FOR THE LOCATION ANDVERIFICATION OF ALL EXISTING UTILITIES AND STRUCTURES. EXERCISE EXTREMECARE IN EXCAVATING AND WORKING NEAR UTILITIES. DAMAGE DONE TO UTILITIES,STRUCTURES, OR OTHER FINISHED WORK SHALL BE REPAIRED OR REPLACED ATTHE IRRIGATION CONTRACTORS EXPENSE.2.IRRIGATION CONTRACTOR TO FIELD ADJUST DRIP LINE LOCATIONS SO AS TO AVOIDCONFLICTS WITH TREES, SITE FURNITURE, AND UTILITIES.3.INSTALL PVC SCHEDULE 40 PIPE SLEEVES UNDER HARDSCAPE AT ALL POINTSWHERE IRRIGATION MAIN LINE AND LATERALS ARE LOCATED.4.INSTALL ALL MAINLINES TO SLOPE AT 1% MINIMUM TO MANUAL DRAIN VALVESLOCATED AT LOW POINTS OR AS INDICATED ON PLANS OF MAINLINE SYSTEM.5.THE CONTRACTOR SHALL PLACE A #12 SOLID COPPER TRACE WIRE WITH PURPLE PECOVER FOR WATER ALONG ALL PVC MAINLINE. THIS INCLUDES ALL PVC MAINLINECONNECTING QUICK COUPLER VALVES.6.THE IRRIGATION CONTRACTOR SHALL COORDINATE WITH GENERAL CONTRACTORTO INSURE THE POINT OF CONNECTION IS PROVIDED PER PLANS.7.INSTALL A BACKFLOW PREVENTER AND ENCLOSURE AT THE POINT OF CONNECTION.INSTALL PER MANUFACTURER SPECIFICATIONS. COORDINATE WITH LOCAL CITYORDINANCES TO ENSURE THE POINT OF CONNECTION MEETS ALL CODES.8.IRRIGATION CONTRACTOR SHALL INSTALL DRIP IRRIGATION SYSTEM FOR ALLPLANTING AREAS AND SPRAY HEADS FOR TURF LAWN AREAS.9.CONTRACTOR TO SUBMIT IRRIGATION PLAN AND PRODUCT INFORMATION TOLANDSCAPE ARCHITECT FOR REVIEW AND APPROVAL PRIOR TO INSTALLATION.SUBMIT IRRIGATION PLAN AT A SCALE OF 1 INCH EQUALS 30 FEET OR GREATERINDICATING POINT OF CONNECTION, BACKFLOW PREVENTER, LAYOUT / LOCATIONSOF DRIP-LINE, VALVES, MAINLINE, ISOLATION VALVES, FLOW SENSORS, RAIN /FREEZE SENSOR, PIPE SIZING, AND CONTROLLER LOCATIONS.10.CONTRACTOR TO INSTALL NEW TORO CUSTOM COMMAND SERIES / HUNTER ACC-D /RAIN BIRD ESP-LXIVM (OR APPROVED EQUAL) CONTROLLER WITH STAINLESS STEELPEDESTAL MOUNT. SOURCE IRRIGATION CONTROLLER, RAIN / FREEZE SENSOR,QUICK COUPLERS, AND CONTROL VALVES FROM ONE MANUFACTURER.CONTRACTOR TO VERIFY 110V UNINTERRUPTED ELECTRICAL SERVICE FOR THECONTROLLER. CONTRACTOR TO INSTALL CONTROLLER PER MANUFACTURER'SSPECIFICATIONS.11.INSTALL VALVE BOX LOCATIONS IN PLANTING AREAS, PARALLEL TO AND SET BACKFROM PAVEMENT EDGES AS INDICATED ON THE PLANS.12.PROTECT AT ALL TIMES THE WORK FROM DAMAGE AND THEFT. REPLACE ALLDAMAGED OR STOLEN PARTS AT CONTRACTOR'S EXPENSE UNTIL THE WORK ISACCEPTED IN WRITING BY THE OWNER'S REPRESENTATIVE.IRRIGATION NOTES 1015PROPOSED BUILDINGFFE = 943.3842,881 SQ. FT.16XXXXXXXXXXXXXXXXXXXXXXXXXXXX X X X NO PARKINGNO PARKINGINFILTRATION BASINTOP = 937.50100-YR HWL = 937.50BOTTOM = 936.00X X XXXXX GM20WATERMAIN EASEMENT PERDOCUMENT NO. 2755908Rosewood WestAugustana Care CorporationGethsemane Evangelical Lutheran Church The Augustana Home of MinneapolisStairs5th AVENUE NORTHWATERMAIN EASEMENT PERDOCUMENT NO. 275590833340.4 (deed)DRAINAGE & UTILITY EASEMENTPER DOC. NO. 693519 5' BUILDING SETBACK25' BUILDING SETBACK5' BUILDING SETBACK20' BUILDING SETBACK6" EXISTING WATERMAIN>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>II I II I (1) PC(1) PC(1) AG(2) UP(1) AG(2) UP(3) UT(3) UP(3) UT(3) UP(1) GS(6) RG(1) GE(1) AA(1) GE(1) AA(1) GS(7) RG(17) BV(3) FG(3) HP(5) AP(11) NL(5) BE(5) TW(2) FG(5) TW(2) FG(5) NL(7) BV(4) TO(5) CK(10) NL(10) BV(5) AP(4) NL(6) HP(5) AP(3) NL(11) TW(5) TT(18) TW(19) CP(4) AC(4) NL(11) CP(5) AL(1) HP(2) HP(2) QB(1) GE(1) GE(1) AA(10) CK(7) TW(10) CK(6) TW(1) CO(1) CO(1) CO(7) BV(5) RG(3) RG(3) RG(1) MS(1) UT(1) MS(2) HP(6) AL(1) HP(1) HP(6) AL(6) AL(114) PG(1) HP(5) AL(5) NL(3) HP(5) NL(5) AP(6) AC(66) PG(1) MS(3) GR(5) AP(3) HP(2) HP(3) FG(14) CK(108) PG(7) AC(3) HP(6) NL(76) PG(5) NL(5) AP(12) TW(7) NL(3) GR(13) CP(3) AC(5) AC(5) GR(3) HP(2) TW(3) AB(3) TW(3) TW(3) AB(1) CO(3) RG(3) BV(2) HP(7) CK(5) BV(12) CK(15) CK(3) FG(5) BV(7) CK(15) AL(1) AA(1) GE(1) AA(1) GE(1) AA(1) GE(1) AA(1) GE(1) AA(8) BE(13) BV(3) AB(4) BE(6) BV(3) AB(14) BE(21) BV(4) AB(7) BE(9) BV(4) AB(7) BE(9) BV(4) AB(6) BE(8) BV(5) AB(12) NL(15) AL(7) NL(3) HP(7) BE(8) BV(4) AB(4) AB(7) BE(10) BV(4) AB(7) TW(9) NL(3) HP(9) NL(16) GR(2) AG(7) NL(14) BV(7) NL(1) GS(1) MS(1) GS(3) HP(5) AL(3) GR(5) GRTREESCODEQTYBOTANICAL / COMMON NAMESIZEROOTAA8ACER RUBRUM `JFS-KW78`ARMSTRONG GOLD® MAPLE2.5" CALB & BAG4AMELANCHIER X GRANDIFLORA 'AUTUMN BRILLIANCE'AUTUMN BRILLIANCE APPLE SERVICEBERRY6` HT MINB & BCO4CELTIS OCCIDENTALISCOMMON HACKBERRY2.5" CALB & BGE8GINKGO BILOBA 'BLAGON'GOLDSPIRE MAIDENHAIR TREE2.5" CALB & BGS4GLEDITSIA TRIACANTHOS INERMIS 'SKYLINE'SKYLINE HONEY LOCUST2.5" CAL MIN.B & BMS4MALUS X 'SPRING SNOW'SPRING SNOW CRABAPPLE2" CALB & BPC2PYRUS CALLERYANA 'GLEN'S FORM'CHANTICLEER® CALLERY PEAR2.5" CALB & BQB2QUERCUS BICOLORSWAMP WHITE OAK2.5" CALB & BTO4THUJA OCCIDENTALIS 'SMARAGD'EMERALD GREEN ARBORVITAE6` HT MINB & BTT5THUJA OCCIDENTALIS `TECHNY`TECHNY ARBORVITAE6` HT MINB & BUP10ULMUS AMERICANA 'PRINCETON'PRINCETON AMERICAN ELM2.5" CALB & BUT7ULMUS X 'MORTON GLOSSY'TRIUMPH™ ELM2.5" CALB & BSHRUBSCODEQTYBOTANICAL / COMMON NAMESIZEROOTAB41ARONIA MELANOCARPA 'AUTUMN MAGIC'AUTUMN MAGIC BLACK CHOKEBERRY5 GALCONTAL63ARONIA MELANOCARPA 'UCONNAM165'LOW SCAPE MOUND® BLACK CHOKEBERRY5 GALCONTAC25AZALEA X 'CANDY LIGHTS'CANDY LIGHTS NORTHERN LIGHTS AZALEA5 GALCONTBE65BERBERIS THUNBERGII `NCBT1`SUNJOY MINI MAROON® BARBERRY5 GALCONTBV152BUXUS X `GREEN VELVET`GREEN VELVET BOXWOOD5 GALCONTFG13FORSYTHIA X 'COURTANEUR'GOLD CLUSTER FORSYTHIA5 GALCONTHP42HYDRANGEA PANICULATA 'ILVOBO'BOBO® PANICLE HYDRANGEA5 GALCONTRG27RHUS AROMATICA 'GRO-LOW'GRO-LOW FRAGRANT SUMAC5 GALCONTTW79TAXUS X MEDIA 'TAUNTON'TAUNTON YEW3 GALCONTPERENNIALSCODEQTYBOTANICAL / COMMON NAMESIZEROOTAP30ASTER NOVAE-ANGLIAE 'PINK CRUSH'PINK CRUSH NEW ENGLAND ASTER1 GALCONTCK80CALAMAGROSTIS X ACUTIFLORA 'KARL FOERSTER'KARL FOERSTER FEATHER REED GRASS1 GALCONTCP43CAREX PENSYLVANICAPENNSYLVANIA SEDGE6" POTGR35GERANIUM X 'ROZANNE'ROZANNE CRANESBILL1 GALCONTNL116NEPETA X FAASSENII 'WALKER'S LOW'WALKER'S LOW CATMINT1 GALCONTSHRUB AREASCODEQTYBOTANICAL / COMMON NAMEROOTSIZESPACINGPG298PACHYSANDRA TERMINALIS 'GREEN CARPET'GREEN CARPET JAPANESE PACHYSANDRA2.5" PLUGPLUG9" o.c.PLANT SCHEDULETITLESHEET29290 C5-LANDPROJECT NO.FILE NAMEDRAWN BYDESIGNED BYREVIEWED BYORIGINAL ISSUE DATECLIENT PROJECT NO.BYDESCRIPTIONREVISION SCHEDULEDATEPROJECTWITHOUT PRIOR WRITTEN CONSENT.INC. AND MAY NOT BE USED, COPIED OR DUPLICATED THIS DOCUMENT IS THE PROPERTY OF I & S GROUP,DWG LOCATION: S:\PROJECTS\29000 PROJ\29200-29299\29290 CASSIA CHAPEL VIEW CARE CENTER-HOPKINS MN\29290 PRODUCTION FILES\29290 CIVIL 3D\PRODUCTION DWGS\29290 C5-LAND.DWG SAVED BY: BILL.KARELS C5-20SITE PLANTINGPLAN-08/25/23C5-20 SITE PLANTING PLAN 300 29290 C5-2023-29290HOPKINSMINNESOTA 0SCALE IN FEET2040BJK/TMKBJK/TMKRASCASSIACHAPEL VIEWCARE CENTERLIC. NO.DATEPROFESSIONAL ENGINEER UNDER THE LAWS OF THESTATE OF MINNESOTA.I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSEDPRELIMINARY NOT FOR CONSTRUCTION PRELIMINARY NOT FOR CONSTRUCTION PLOT DATE: 8/25/2023 10:45 AM REESE A. SUDTELGTE54243NOTE:THE CLARITY OF THESE PLANS DEPENDUPON COLOR COPIES. IF THIS TEXT DOESNOT APPEAR IN COLOR, THIS IS NOT ANORIGINAL PLAN SET AND MAY RESULT INMISINTERPRETATION. TITLESHEET29290 C5-LANDPROJECT NO.FILE NAMEDRAWN BYDESIGNED BYREVIEWED BYORIGINAL ISSUE DATECLIENT PROJECT NO.BYDESCRIPTIONREVISION SCHEDULEDATEPROJECTWITHOUT PRIOR WRITTEN CONSENT.INC. AND MAY NOT BE USED, COPIED OR DUPLICATED THIS DOCUMENT IS THE PROPERTY OF I & S GROUP,DWG LOCATION: S:\PROJECTS\29000 PROJ\29200-29299\29290 CASSIA CHAPEL VIEW CARE CENTER-HOPKINS MN\29290 PRODUCTION FILES\29290 CIVIL 3D\PRODUCTION DWGS\29290 C5-LAND.DWG SAVED BY: BILL.KARELS C5-30PLANTING NOTESAND DETAILS-08/25/23C5-30 PLANTING NOTES AND DETAILS 300 29290 C5-3023-29290HOPKINSMINNESOTA BJK/TMKBJK/TMKRASCASSIACHAPEL VIEWCARE CENTERLIC. NO.DATEPROFESSIONAL ENGINEER UNDER THE LAWS OF THESTATE OF MINNESOTA.I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSEDPRELIMINARY NOT FOR CONSTRUCTION PRELIMINARY NOT FOR CONSTRUCTION PLOT DATE: 8/25/2023 10:45 AM REESE A. SUDTELGTE54243NOTE:THE CLARITY OF THESE PLANS DEPENDUPON COLOR COPIES. IF THIS TEXT DOESNOT APPEAR IN COLOR, THIS IS NOT ANORIGINAL PLAN SET AND MAY RESULT INMISINTERPRETATION.1.COORDINATE LOCATION OF ALL UTILITIES (LINES, DUCTS, CONDUITS, SLEEVES,FOOTINGS, ETC.) WITH LOCATIONS OF PROPOSED LANDSCAPE ELEMENTS (FENCE,FOOTINGS, TREE ROOTBALLS, ETC.). CONTRACTOR SHALL REPORT ANYDISCREPANCIES TO OWNER'S REPRESENTATIVE PRIOR TO CONTINUING WORK.2.SAVE AND PROTECT ALL EXISTING TREES NOT NOTED TO BE REMOVED.3.REMOVE ALL CONSTRUCTION DEBRIS AND MATERIALS INJURIOUS TO PLANT GROWTHFROM PLANTING PITS AND BEDS PRIOR TO BACKFILLING WITH PLANTING MIX.4.REFER TO PLANTING DETAILS FOR AMENDED SOIL DEPTH IN PLANTING BEDS ANDSURROUNDING TREES.5.FIELD STAKE PLANTINGS ACCORDING TO PLAN. OWNER'S REPRESENTATIVE SHALLAPPROVE ALL PLANT LOCATIONS PRIOR TO INSTALLATION. OWNER'SREPRESENTATIVE RESERVES THE RIGHT TO REVISE PLANTING LAYOUT AT TIME OFINSTALLATION.6.ALL PLANT MATERIALS SHALL BE TRUE TO THEIR SCIENTIFIC NAME AND SIZE ASINDICATED IN THE PLANT SCHEDULE.7.IF DISCREPANCIES EXIST BETWEEN THE NUMBER OF PLANTS DRAWN ON THEPLANTING PLAN AND THE NUMBER OF PLANTS IN THE SCHEDULE, THE PLANTING PLANSHALL GOVERN.8.ANY PROPOSED SUBSTITUTIONS OF PLANT SPECIES SHALL BE MADE WITH PLANTS OFEQUIVALENT OVERALL FORM, HEIGHT, BRANCHING HABIT, FLOWER, LEAF, COLOR,FRUIT AND CULTURE, AND ONLY AFTER WRITTEN APPROVAL OF THE OWNER'SREPRESENTATIVE.9.ALL PLANT MATERIALS MUST CONFORM TO AMERICAN STANDARDS FOR NURSERYSTOCK (ANSI Z60.1), LATEST EDITION PUBLISHED BY THE AMERICAN ASSOCIATION OFNURSERYMEN, WASHINGTON D.C. LARGER SIZED PLANT MATERIALS OF THE SPECIESLISTED MAY BE USED IF THE STOCK CONFORMS TO ANSI Z60.1.10.ALL PLANT MATERIAL SHALL BE GUARANTEED BY THE CONTRACTOR TO BE IN A LIVEAND HEALTHY GROWING CONDITION FOR ONE FULL GROWING SEASON (ONE YEAR)AFTER FINAL PROJECT ACCEPTANCE OR SHALL BE REPLACED BY THE CONTRACTORFREE OF CHARGE WITH THE SAME GRADE AND SPECIES.11.ALL TREES SHALL HAVE A STRONG CENTRAL LEADER. ANY TREES DEEMED NOT TOHAVE A STRONG CENTRAL LEADER SHALL BE REJECTED.12.CONTRACTOR IS RESPONSIBLE FOR ALL DAMAGE DUE TO CONSTRUCTIONOPERATIONS. ANY AREAS THAT ARE DISTURBED SHALL BE RESTORED TO ITSORIGINAL CONDITION AT NO ADDITIONAL COST TO THE OWNER.13.PROVIDE SHREDDED HARDWOOD MULCH SURROUNDING ALL PROPOSED TREES (5' Ø)AND WITHIN PLANTING BEDS AS NOTED ON SITE RESTORATION PLAN TO A 3" MINIMUMDEPTH AS SHOWN IN PLANTING DETAILs. DO NOT USE AN UNDERLAYMENT SUCH ASPLASTIC SHEET OR LANDSCAPE FABRIC. APPLY PRE-EMERGENT TO ALL PLANTINGBEDS PRIOR TO MULCHING. REFER TO PLANS FOR ADDITIONAL DETAILS. REFER TOSTORMWATER DETAILS FOR BASIN CONSTRUCTION AND MULCH APPLICATION.14.PROVIDE 1-1/2" RIVER ROCK MULCH TO A DEPTH OF 3" IN ALL AREAS INDICATED ONSITE RESTORATION PLAN. LANDSCAPE FABRIC SHALL BE USED IN ALL ROCK MULCHAREAS.15.MULCHING MATERIAL SHALL BE SHREDDED HARDWOOD MULCH, WITH NO INDIVIDUALPIECES LARGER THAN 3", FREE OF GROWTH OR GERMINATION INHIBITINGINGREDIENTS, AND 1-1/2" RIVER ROCK. 3" MINIMUM DEPTHS AT LOCATIONS INDICATEDON DRAWINGS.16.CONTRACTOR SHALL PROVIDE SAMPLE OF MULCH TO BE APPROVED BY THELANDSCAPE ARCHITECT.17.INDICATED QUANTITIES ARE ESTIMATES AND SHALL BE CONFIRMED BY THECONTRACTOR.18.ADJUST SPACING OF PLANT MATERIALS AROUND ADJACENT UTILITY STRUCTURES.PLANTING NOTESLANDSCAPE EDGINGNTSUNDISTURBED SUBGRADELANDSCAPE EDGINGMULCHAMENDED SOILFINISH GRADE@ LAWN1 2"LANDSCAPE EDGING:3/16" X 4" WITH 3/16" X 1'-4"LENGTH STAKES @ 2'-6" OCMATERIAL: ALUMINUMFINISH:MILL FINISHPERENNIAL PLANTINGNTSFINISH GRADEEDGE OF BEDEDGE OF PLANTING BED / GROUNDCOVER AREAINSTALL PLANTS PER PLANS AND PLANT LISTSPACING - ALL PLANTS SHALL BE EQUALLYSPACED TO ACHIEVE A SYMMETRICALLAYOUT FOR BOTH TRIANGULAR AND LINEARPLANTING SCHEMES12 SPECIFIEDPLANT SPACINGSYMMETRICALSPACINGTILL ALL PLANT BEDS TO A MINIMUMDEPTH OF 6" AND BACKFILL PERSPECIFICATIONS, WHEN PROVIDED - INAREAS WITH HEAVY CLAY OR ROCKYSOILS AMEND WITH AMENDED PLANTINGSOIL FROM A LOCAL SOURCE. PLACECONTAINER ON UNDISTURBED SOIL ANDENSURE PLANT IS PLUMBCUT AND REMOVE THE ENTIRE CONTAINERAND SCARIFY, AS NECESSARY, ROOTS FORALL CONTAINERIZED PLANTS #5 GALLONSOR SMALLER3" LAYER OF MULCH. REFER TO PLANTINGNOTES AND RESTORATION PLAN FORMULCH TYPE.PERENNIALS TO BE INSTALLED SO THAT THETOP OF THE CROWN OF THE PLANT ISSLIGHTLY ABOVE FINISH GRADEPLANSECTIONSHRUB PLANTINGNTSROOTBALL DIA2X CONTAINER DIA2X ROOTBALL DIACONTAINER DIAEXCAVATE PLANTING PIT TO A DEPTH EQUALTO THE DEPTH OF THE ROOTBALL ORCONTAINER MINUS 3" AND A MIN TWICE THEDIAMETER OF THE ROOTBALL OR CONTAINER.PLACE ROOTBALL ON UNDISTURBED SOIL ANDENSURE PLANT IS PLUMB.3" LAYER OF MULCH. REFER TO PLANTINGNOTES AND RESTORATION PLAN FOR MULCHTYPE.BACKFILL PLANTING PIT WITH NATIVESOIL-EXCEPT WHEN IN HEAVY CLAY, MIXAMENDED TOPSOIL FROM A LOCAL SOURCEWITH NATIVE SOILSHRUBS TO BE INSTALLED SO THAT THE TOPOF THE CROWN OF THE PLANT IS ABOVEFINISH GRADE 3"CUT AND REMOVE MIN TOP HALF OF WIREBASKETS, BURLAP AND/OR TWINE, OR ENTIRECONTAINER, AND REMOVE FROM THEPLANTING PIT, SCARIFY ROOTS FOR ALLCONTAINER PLANTS #5 GALLON OR SMALLERMULTI-STEM TREE PLANTINGNTSFINISH GRADENOTE:1. DO NOT STAKE TREES2. THOROUGHLY WATER-IN ALLTREES IMMEDIATELY AFTERPLANTING AND ENSURE NOUNDESIRABLE SETTLINGOCCURS - TREE STAYS PLUMBROOTBALL DIA2X ROOTBALL DIADO NOT CUT PRIMARY LEADERS - 3 LARGESTDIAMETER STEMSPRUNE ALL BROKEN, DAMAGED, OR RUBBINGLIMBS AND BRANCHES IMMEDIATELY AFTERPLANTING - ALL PRUNING CUTS CLEAN AT 90°CUT AND REMOVE TOP HALF OF WIREBASKETS, BURLAP AND/OR TWINE ANDREMOVE FROM THE PLANTING PIT. AVOIDCUTTING OR SCARRING ROOTS. ANY ROOTSTHAT ARE SCARRED OR BROKEN DURINGPLANTING SHALL BE PRUNED AT 90°BACKFILL PLANTING PIT WITH NATIVESOIL-EXCEPT WHEN IN HEAVY CLAY, MIXAMENDED TOPSOIL FROM A LOCAL SOURCEWITH NATIVE SOILEXCAVATE PLANTING PIT TO A DEPTH EQUALTO THE DEPTH OF THE ROOTBALL MINUS 3"AND TWICE THE DIAMETER OF THE ROOTBALL.PLACE ROOTBALL ON UNDISTURBED SOIL ANDENSURE TRUNK OF TREE IS PLUMB3" LAYER OF MULCH MOUNDED AT EDGE TOFORM A SHALLOW SAUCER - DO NOT PLACEMULCH DIRECTLY ON TREE TRUNK, LEAVE AMINIMUM 3" RING AROUND CROWN. REFER TOPLANTING NOTES AND RESTORATION PLANFOR MULCH TYPE.SET ROOT FLARE 3" ABOVE FINISH GRADEEVERGREEN TREE PLANTINGNTSDO NOT CUT PRIMARY LEADER. ALL TREESSHALL HAVE A STRONG (CENTRAL) DOMINATELEADERFINISH GRADETREES 8'+TREES 6'-8'HARDWOOD STAKES 2"X2"X8' LENGTH -INSTALL OUTSIDE OF ROOTBALL AT 5' MAX HTSTAKING DIAGRAM,NO STAKING TREESUNDER 6'ROOTBALL DIA2X ROOTBALL DIATIE NYLON STRAP AROUND TRUNK AS SHOWNCUT AND REMOVE TOP HALF OF WIREBASKETS, BURLAP AND/OR TWINE ANDREMOVE FROM THE PLANTING PIT. AVOIDCUTTING OR SCARRING ROOTS. ANY ROOTSTHAT ARE SCARRED OR BROKEN DURINGPLANTING SHALL BE CUT CLEAN AT 90°BACKFILL PLANTING PIT WITH NATIVESOIL-EXCEPT WHEN IN HEAVY CLAY, MIXAMENDED TOPSOIL FROM A LOCAL SOURCEWITH NATIVE SOILEXCAVATE PLANTING PIT TO A DEPTH EQUALTO THE DEPTH OF THE ROOTBALL MINUS 3"AND TWICE THE DIAMETER OF THE ROOTBALL.PLACE ROOTBALL ON UNDISTURBED SOIL ANDENSURE TRUNK OF TREE IS PLUMB3" LAYER OF MULCH MOUNDED AT EDGE TOFORM A SHALLOW SAUCER - DO NOT PLACEMULCH DIRECTLY ON TREE TRUNK, LEAVE AMIN. 3" RING AROUND CROWN. REFER TOPLANTING NOTES AND RESTORATION PLANFOR MULCH TYPE.PRUNE ALL BROKEN, DAMAGED, OR RUBBINGLIMBS AND BRANCHES IMMEDIATELY AFTERPLANTINGSET ROOT FLARE 3" ABOVE FINISH GRADE1/2" WIDE NYLON STRAPPING - GREEN ORBROWN COLORDECIDUOUS TREE PLANTINGNTSPRUNE ALL BROKEN, DAMAGED, OR RUBBINGLIMBS AND BRANCHES IMMEDIATELY AFTERPLANTING - ALL PRUNING CUTS CLEAN AT 90°FINISHGRADESTAKING DIAGRAMDO NOT CUT PRIMARY LEADER. ALL TREESSHALL HAVE A STRONG (CENTRAL)DOMINATE LEADERTREES 8'+TREES 6'-8'TIE NYLON STRAP AROUND TRUNK AS SHOWNSET ROOT FLARE 3" ABOVE FINISH GRADEBACKFILL PLANTING PIT WITH NATIVESOIL-EXCEPT WHEN IN HEAVY CLAY, MIXAMENDED TOPSOIL FROM A LOCAL SOURCEWITH NATIVE SOILEXCAVATE PLANTING PIT TO A DEPTH EQUALTO THE DEPTH OF THE ROOTBALL MINUS 3"AND TWICE THE DIAMETER OF THE ROOTBALL.PLACE ROOTBALL ON UNDISTURBED SOIL ANDENSURE TRUNK OF TREE IS PLUMB3" LAYER MULCH MOUNDED AT EDGE TOFORM A SHALLOW SAUCER - DO NOT PLACEMULCH DIRECTLY ON TREE TRUNK, LEAVE AMIN. 3" RING AROUND CROWN - REFER TOPLANTING NOTES AND RESTORATION PLANFOR MULCH TYPE.HARDWOOD STAKES 2"X2"X8' LONG - INSTALLOUTSIDE OF ROOTBALL AT 5' MAX HT1/2" WIDE NYLON STRAPPING - GREEN ORBROWN COLORCUT AND REMOVE TOP HALF OF WIREBASKETS, BURLAP AND/OR TWINE ANDREMOVE FROM THE PLANTING PIT. AVOIDCUTTING OR SCARRING ROOTS. ANY ROOTSTHAT ARE SCARRED OR BROKEN DURINGPLANTING SHALL BE PRUNED 90°ROOTBALL DIA2X ROOTBALL DIA TITLESHEET29290 C5-LANDPROJECT NO.FILE NAMEDRAWN BYDESIGNED BYREVIEWED BYORIGINAL ISSUE DATECLIENT PROJECT NO.BYDESCRIPTIONREVISION SCHEDULEDATEPROJECTWITHOUT PRIOR WRITTEN CONSENT.INC. AND MAY NOT BE USED, COPIED OR DUPLICATED THIS DOCUMENT IS THE PROPERTY OF I & S GROUP,DWG LOCATION: S:\PROJECTS\29000 PROJ\29200-29299\29290 CASSIA CHAPEL VIEW CARE CENTER-HOPKINS MN\29290 PRODUCTION FILES\29290 CIVIL 3D\PRODUCTION DWGS\29290 C5-LAND.DWG SAVED BY: BILL.KARELS C5-31TREE SURVEY-08/25/23C5-31 TREE SURVEY 300 29290 C5-3123-29290HOPKINSMINNESOTA BJK/TMKBJK/TMKRASCASSIACHAPEL VIEWCARE CENTERLIC. NO.DATEPROFESSIONAL ENGINEER UNDER THE LAWS OF THESTATE OF MINNESOTA.I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSEDPRELIMINARY NOT FOR CONSTRUCTION PRELIMINARY NOT FOR CONSTRUCTION PLOT DATE: 8/25/2023 10:45 AM REESE A. SUDTELGTE54243NOTE:THE CLARITY OF THESE PLANS DEPENDUPON COLOR COPIES. IF THIS TEXT DOESNOT APPEAR IN COLOR, THIS IS NOT ANORIGINAL PLAN SET AND MAY RESULT INMISINTERPRETATION. PROPOSED BUILDINGFFE = 943.3842,881 SQ. FT.XXXXXXXXXXXXXXXXXXXXXXXXXXXX X X X NO PARKINGNO PARKINGOHLOHLOH L OHL OHLOHLOHL OHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHL X XXXXX GMRosewood WestAugustana Care CorporationGethsemane Evangelical Lutheran Church Stairs5th AVENUE NORTH PROPERTY LINEPROPERTY LINE 5' BUILDING SETBACK25' BUILDING SETBACK5' BUILDING SETBACK20' BUILDING SETBACK>II I II I0.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.20.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.20.20.20.20.20.10.10.10.10.10.10.10.10.20.20.20.30.40.40.40.40.40.30.30.20.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.20.30.30.40.40.60.60.60.60.50.50.40.40.40.40.30.30.40.40.50.60.70.91.01.01.00.80.70.50.30.20.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.20.40.71.11.41.61.71.61.41.21.31.31.41.41.21.00.70.70.81.11.51.82.22.42.32.22.01.81.51.10.60.40.30.20.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.30.51.11.82.73.03.02.92.52.11.92.22.72.62.11.51.10.91.11.82.63.44.04.34.63.63.33.62.61.71.00.70.50.30.30.20.20.20.10.10.10.00.00.00.00.00.10.10.00.00.00.00.00.00.10.10.30.61.31.92.92.73.63.72.31.61.62.12.61.61.31.00.91.11.72.33.63.74.14.94.03.74.33.22.21.51.20.90.70.60.50.50.40.40.30.20.00.00.00.00.06.60.20.10.10.00.00.00.00.00.00.10.20.30.71.10.90.51.01.01.01.01.01.11.31.72.12.31.91.62.02.01.71.31.11.00.90.80.80.60.00.00.012.20.40.20.10.10.00.00.00.00.10.10.10.30.40.41.41.71.81.92.02.12.22.53.43.62.62.43.43.62.62.22.12.01.91.81.71.32.40.40.30.20.10.10.00.00.00.10.10.30.50.80.82.03.13.62.82.93.72.91.92.63.83.02.83.53.32.10.80.80.60.30.20.10.00.00.00.10.20.40.81.51.92.13.33.73.03.13.83.21.93.04.03.32.93.63.52.31.91.50.90.50.20.10.00.00.00.10.20.51.12.53.73.42.71.30.60.30.10.00.00.00.10.30.61.32.73.93.72.91.40.70.30.10.10.00.00.10.30.61.32.22.82.72.31.50.70.30.10.10.00.00.10.30.61.32.22.82.82.31.50.70.30.10.10.00.00.10.30.61.32.74.03.83.01.40.70.30.10.10.00.00.10.20.51.12.33.53.42.71.30.60.30.10.00.00.00.10.20.40.81.41.81.81.50.90.50.20.10.00.00.00.10.10.20.50.70.70.70.70.50.30.20.10.00.00.00.10.10.20.51.02.03.13.60.00.00.00.02.53.63.10.10.111.612.010.77.67.92.80.10.02.83.82.70.00.00.00.03.43.42.31.10.60.30.10.10.00.00.00.00.10.20.50.91.62.62.91.80.90.50.50.61.11.93.02.41.40.70.71.86.95.87.89.610.42.80.30.40.71.32.23.12.11.20.60.50.50.81.62.82.81.91.00.50.30.10.00.00.00.10.10.20.30.61.11.51.61.51.20.80.60.61.01.21.41.51.30.90.61.414.013.71.35.29.610.63.00.50.81.01.21.41.51.41.10.91.00.80.91.31.72.01.50.90.50.30.10.10.00.00.10.30.61.32.02.62.72.41.71.21.11.52.02.62.62.31.61.00.70.51.520.32.23.23.718.72.10.75.29.711.03.91.92.42.62.31.91.61.72.22.52.72.42.32.52.83.02.61.91.00.50.20.10.00.00.20.30.71.21.72.22.21.91.41.11.01.41.82.22.21.81.20.80.50.40.71.61.72.93.22.61.20.63.56.06.83.11.62.12.22.01.61.41.51.92.22.42.22.12.22.32.52.21.60.90.50.30.10.10.00.10.20.30.50.60.70.70.70.60.60.60.70.70.70.70.70.50.40.30.30.40.71.11.41.51.20.70.40.30.30.40.50.60.70.70.80.70.70.70.80.80.90.90.90.90.90.80.80.60.50.30.20.10.10.00.10.10.10.10.10.10.10.20.20.20.20.20.20.10.10.10.20.10.10.20.20.40.50.60.60.50.40.20.20.10.10.10.10.10.20.20.20.20.20.20.20.20.20.20.20.20.20.20.20.10.10.10.10.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.10.10.10.10.10.10.10.20.30.30.30.30.20.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.10.10.10.10.10.10.10.10.10.10.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.00.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.5 0.50.50.50.50.50.5 0.5 0.5 0.5 0.5 0.5 0.50.50.50.50.50.50.50 . 5 0.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.50.5TITLESHEET29290 E2-LIGHTING 2-POLESPROJECT NO.FILE NAMEDRAWN BYDESIGNED BYREVIEWED BYORIGINAL ISSUE DATECLIENT PROJECT NO.BYDESCRIPTIONREVISION SCHEDULEDATEPROJECTWITHOUT PRIOR WRITTEN CONSENT.INC. AND MAY NOT BE USED, COPIED OR DUPLICATED THIS DOCUMENT IS THE PROPERTY OF I & S GROUP,DWG LOCATION: S:\PROJECTS\29000 PROJ\29200-29299\29290 CASSIA CHAPEL VIEW CARE CENTER-HOPKINS MN\29290 PRODUCTION FILES\29290 CIVIL 3D\PRODUCTION DWGS\29290 E2-LIGHTING 2-POLES.DWG SAVED BY: KYLE.MCCONNELL E2-02SITE LIGHTINGPHOTOMETRICPLAN-08/25/23E2-02 SITE LIGHTING PHOTOMETRIC PLAN 300 29290 E2-0223-29290HOPKINSMINNESOTA 0SCALE IN FEET2040KDMKDMRASCASSIACHAPEL VIEWCARE CENTERLIC. NO.DATEPROFESSIONAL ENGINEER UNDER THE LAWS OF THESTATE OF MINNESOTA.I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSEDPRELIMINARY NOT FOR CONSTRUCTION PRELIMINARY NOT FOR CONSTRUCTION PLOT DATE: 8/25/2023 12:08 PM REESE A. SUDTELGTE54243NOTE:THE CLARITY OF THESE PLANS DEPENDUPON COLOR COPIES. IF THIS TEXT DOESNOT APPEAR IN COLOR, THIS IS NOT ANORIGINAL PLAN SET AND MAY RESULT INMISINTERPRETATION.LIGHT FIXTURE SCHEDULELABELMANUFACTURERCATALOG NUMBERDESCRIPTIONLAMPMOUNTING HEIGHTLAMP LUMENSLLFWATTSREMARKSBH.E. WILLIAMSOSA6S-L20/840-AC-FT-XXX-AB-OPTIONS-DIM-UNV6" ALUMINUM BOLLARD - SQUARE27W LED3 FEET2,0460.9027.1W40" BOLLARD LIGHTCCONTECH LIGHTINGR6NC240K12D6 / RL-KIT / C6322M-CLR6" RECESSED DOWN LIGHT16W LED14 FEET1,6000.9016WRECESS FIXTURE IN EXTERIOR CANOPYWH.E. WILLIAMSVWPV-L60/740-TFT-XXX-CGL-OPTIONS-DIM-UNVARCHITECTURAL WALL PACK70W LED14 FEET5,9990.9070WSURFACE MOUNT FIXTURE TO BUILDING EXTERIORYLITHONIADSX0 LED P1 35K 80CRI T2M MVOLT SPA HS XXXXX12' POLE LIGHT34W LED12 FEET4,7360.9034WPROVIDE WITH 12'-0" POLE(#SSS-12-4C-DM19AS-VD-XXXXX)NOTE: SEE ELECTRICAL PLANFOR SITE ELECTRICAL LAYOUTFOOTCANDLE LEGEND1.00 FOOTCANDLE LINE0.50 FOOTCANDLE LINE0.5BBBBBBCCCCCCCCCCCCCWWWWWYWWWWWWWWWWWWWWYYYYYYY LIGHT POLE DETAILN.T.S.1 X X X XXXXXXXOHLOHLOH L OH L OHLOHLOHL OHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHL OHLOHLOHLX X IIII I I I I I I I I I I I IIIIIIIIIIIIIIIIIIIXXXXX GMEX CBRIM=937.13EX m area drainRIM=937.9420WATERMAIN EASEMENT PERDOCUMENT NO. 2755908Rosewood WestAugustana Care CorporationMonumentSignGethsemane Evangelical Lutheran Church The Augustana Home of MinneapolisSignStairs5th AVENUE NORTHWATERMAIN EASEMENT PERDOCUMENT NO. 27559083314,014 sq. ft.412 5th Avenue340.4 (deed)DRAINAGE & UTILITY EASEMENTPER DOC. NO. 693519 PROPERTY LINEPROPERTY LINER=935.02EX ST MHI=924.37 (18" PVC) EI=924.50 (OTHER" OTHER) SUMP BEND AT CENTER OF SUMP FLOW LINEI=924.41 (18" PVC) SW FLOWS NE TO BEND IN SUMP>>>>>>>>>>>>>>>>938 PCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPC PCPCPCPCPCPCPCPCPC PCPCPCPCPCPCPCPC PC PC PC PC PC PC PC PC PCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPC TITLESHEET29290 C1-SWPPPPROJECT NO.FILE NAMEDRAWN BYDESIGNED BYREVIEWED BYORIGINAL ISSUE DATECLIENT PROJECT NO.BYDESCRIPTIONREVISION SCHEDULEDATEPROJECTWITHOUT PRIOR WRITTEN CONSENT.INC. AND MAY NOT BE USED, COPIED OR DUPLICATED THIS DOCUMENT IS THE PROPERTY OF I & S GROUP,DWG LOCATION: S:\PROJECTS\29000 PROJ\29200-29299\29290 CASSIA CHAPEL VIEW CARE CENTER-HOPKINS MN\29290 PRODUCTION FILES\29290 CIVIL 3D\PRODUCTION DWGS\29290 C1-SWPPP.DWG SAVED BY: BILL.KARELS C1-30PRE -CONSTRUCTIONSWPPP-08/25/23C1-30 PRE - CONSTRUCTION SWPPP 300 29290 C1-3023-29290HOPKINSMINNESOTA 0SCALE IN FEET2040BJK/TMKBJK/TMKRASCASSIACHAPEL VIEWCARE CENTERLIC. NO.DATEPROFESSIONAL ENGINEER UNDER THE LAWS OF THESTATE OF MINNESOTA.I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSEDPRELIMINARY NOT FOR CONSTRUCTION PRELIMINARY NOT FOR CONSTRUCTION PLOT DATE: 8/25/2023 10:42 AM REESE A. SUDTELGTE54243NOTE:THE CLARITY OF THESE PLANS DEPENDUPON COLOR COPIES. IF THIS TEXT DOESNOT APPEAR IN COLOR, THIS IS NOT ANORIGINAL PLAN SET AND MAY RESULT INMISINTERPRETATION.EROSION CONTROL LEGENDSYMBOLDESCRIPTIONPERIMETER CONTROLSILT FENCE, PREASSEMBLEDSTORM DRAIN INLET PROTECTIONSTABILIZED CONSTRUCTION EXITCONCRETE WASHOUT AREAEXISTING DRAINAGE ARROWEXISTING CONTOUR (MINOR INTERVAL)EXISTING CONTOUR (MAJOR INTERVAL)PERIMETER CONTROL CAN BE SILT FENCE OR SEDIMENT CONTROL LOG.SEE SITE RESTORATION PLAN FOR FINAL TURF ESTABLISHMENT.NOTE: SWPPP COVERAGE INCLUDES ELECTRIC, GAS, TELEPHONE, AND CABLE INSTALLATION. EACHCOMPANY OR THEIR SUBCONTRACTOR IS RESPONSIBLE TO FOLLOW THE REQUIREMENTS OF THISSWPPP INCLUDING PROVIDING THEIR OWN RESTORATION IF INSTALLATION OCCURS AFTER PRIMARYINSTALLATION OF SEEDING/SODDING/MULCHING DURING CONSTRUCTION OF EACH UTILITY.PCSF101100 1015PROPOSED BUILDINGFFE = 943.3842,881 SQ. FT.16XXXXXXXXXXXXXXXXXXXXXXXXXXXX X X X NO PARKINGNO PARKINGINFILTRATION BASINTOP = 937.50100-YR HWL = 937.50BOTTOM = 936.00OHLOHLOH L OH L OHLOHLOHL OHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHLOHL OHLOHLOHLX X IIII I I I I I I I I I I I IIIIIIIIIIIIIIIIIIIXXXXX GMEX MHRIM=940.79EX MHRIM=940.4120WATERMAIN EASEMENT PERDOCUMENT NO. 2755908Rosewood WestAugustana Care CorporationGethsemane Evangelical Lutheran Church The Augustana Home of MinneapolisStairs5th AVENUE NORTHWATERMAIN EASEMENT PERDOCUMENT NO. 275590833340.4 (deed)DRAINAGE & UTILITY EASEMENTPER DOC. NO. 693519 PROPERTY LINEPROPERTY LINE>>>>>>>>>>>>>>>>938 PCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPC PCPCPCPCPCPCPCPCPC PCPCPCPCPCPCPCPC PC PC PC PC PC PC PC PC PCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPC>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>II I II I 9409409 4 1 9 4 19419419429429429429429 4 2 942 943943943940939 941941941 942942937938939 940940940936 93 6 9369369369 3 6 936936936936936936936936 937937 937 938939941941941942TITLESHEET29290 C1-SWPPPPROJECT NO.FILE NAMEDRAWN BYDESIGNED BYREVIEWED BYORIGINAL ISSUE DATECLIENT PROJECT NO.BYDESCRIPTIONREVISION SCHEDULEDATEPROJECTWITHOUT PRIOR WRITTEN CONSENT.INC. AND MAY NOT BE USED, COPIED OR DUPLICATED THIS DOCUMENT IS THE PROPERTY OF I & S GROUP,DWG LOCATION: S:\PROJECTS\29000 PROJ\29200-29299\29290 CASSIA CHAPEL VIEW CARE CENTER-HOPKINS MN\29290 PRODUCTION FILES\29290 CIVIL 3D\PRODUCTION DWGS\29290 C1-SWPPP.DWG SAVED BY: BILL.KARELS C1-40SWPPP-08/25/23C1-40 SWPPP 300 29290 C1-4023-29290HOPKINSMINNESOTA 0SCALE IN FEET2040BJK/TMKBJK/TMKRASCASSIACHAPEL VIEWCARE CENTERLIC. NO.DATEPROFESSIONAL ENGINEER UNDER THE LAWS OF THESTATE OF MINNESOTA.I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION ORREPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSEDPRELIMINARY NOT FOR CONSTRUCTION PRELIMINARY NOT FOR CONSTRUCTION PLOT DATE: 8/25/2023 10:42 AM REESE A. SUDTELGTE54243NOTE:THE CLARITY OF THESE PLANS DEPENDUPON COLOR COPIES. IF THIS TEXT DOESNOT APPEAR IN COLOR, THIS IS NOT ANORIGINAL PLAN SET AND MAY RESULT INMISINTERPRETATION.PROVIDE ADDITIONAL CONSTRUCTIONENTRANCES AND CONCRETE WASHOUTAREAS AS NEEDED TO MEET CONSTRUCTIONVEHICLE NEEDS. PLACE SIGNS NOTINGENTRANCES FOR THAT USE.LIMITS OF DISTURBANCEPERIMETER CONTROL (TYP)INLETCONTROL (TYP)EROSION CONTROL QUANTITIESITEM NO.DESCRIPTIONUNITSQUANTITY2573.502PROPOSED STORM DRAIN INLET PROTECTIONEACH102573.501STABILIZED CONSTRUCTION EXITEACH12575.504EROSION CONTROL BLANKET, CATEGORY 25SY54PERIMETER CONTROLLF1598CONCRETE WASHOUT AREAEACH1QUANTITIES ARE FOR INFORMATIONAL PURPOSES TO MEET THE REQUIREMENTS OF THE CONSTRUCTIONSTORMWATER PERMIT. NO GUARANTEE IS MADE TO THE ACTUAL QUANTITIES REQUIRED.EROSION CONTROL LEGENDSYMBOLDESCRIPTIONPERIMETER CONTROLSTORM DRAIN INLET PROTECTIONSTABILIZED CONSTRUCTION EXITEROSION CONTROL BLANKET, CATEGORY 25CONCRETE WASHOUT AREAPROPOSED DRAINAGE ARROWEXISTING CONTOUR (MINOR INTERVAL)EXISTING CONTOUR (MAJOR INTERVAL)PROPOSED CONTOUR (MINOR INTERVAL)PROPOSED CONTOUR (MAJOR INTERVAL)PERIMETER CONTROL CAN BE SILT FENCE OR SEDIMENT CONTROL LOG.SEE SITE RESTORATION PLAN FOR FINAL TURF ESTABLISHMENT.NOTE: SWPPP COVERAGE INCLUDES ELECTRIC, GAS, TELEPHONE, AND CABLE INSTALLATION. EACHCOMPANY OR THEIR SUBCONTRACTOR IS RESPONSIBLE TO FOLLOW THE REQUIREMENTS OF THISSWPPP INCLUDING PROVIDING THEIR OWN RESTORATION IF INSTALLATION OCCURS AFTER PRIMARYINSTALLATION OF SEEDING/SODDING/MULCHING DURING CONSTRUCTION OF EACH UTILITY.PC101100101100 767 N. Eustis Street, Suite 190 St. Paul, Minnesota 55114 651.642.9200 popedesign.com Cassia Chapel View PUD - Neighborhood Meeting Minutes September 11, 2023 (7-8PM) 715 Minnetonka Mills, Rd. Hopkins, MN 55343 Attendees: Andrew Centanni / Cassia Adam Lapacz / PDG Paula Sparling / Chapel View Pastor John / Gethsemane Lutheran Church Approximately 21 additional people in attendance (see sign in sheet) Meeting Notes: 1. Pastor John introduction and moment of silence. o Chapel View was originally created by the three surrounding churches to serve the community. 2. Andrew Centanni presentation of project to relocate existing care center. o Asked all in attendance to sign in for documentation. o Explained next steps are Planning and Zoning then City Council. 3. Questions: Question: What is the plan for the houses on 5th? Response: Houses are to stay Q: What direction does the dining room face? R: South Q: What will parking be like? R: Parking will be surface and located around the building back and sides. Q: Traffic flow? R: Maintaining the existing site driveway access. Q: Where is the new Chapel? R: Community room will be on the second floor facing North. Q: How close will the building be to Rosewood Apartments? R: Approximately 90 feet. Q: How does the elevation work from Rosewood – study needs to be done? R: Rosewood is at a higher elevation and the design features a flat roof not to impede views. Elevations are provided in the submittal. Cassia Chapel View September 11, 2023 Page 2 Q: There is TCU and LTC, will there be memory care? R: No, strictly skilled with no assisted living. Q: Will there be stoves and microwaves in units? R: No stove, sometimes there might be a countertop microwave. Q: What is the vehicle access from 5th? R: Same vehicle access location as existing. Q: Will the trees that get removed be replaced with same size and growth level? R: Smaller trees are needed to establish roots. We’ll be following City tree requirements. Q: Are you replacing trees along Rosewood? R: Yes, some, we intend to preserve the existing trees on the East side but the West will need to be removed and replaced for the drive aisle. Q: Property Manager from Rosewood asked to follow up on trees and other items. R: Yes, please provide contact information. Q: How long is the demolition process? R: Not sure on specifics, but best guess would be 6-8 weeks. Q: What happens with church items? R: Some might be donated. Q: Is there a quiet room? R: One of the living rooms could be designed not to have a TV to provide a quieter space outside the units. Q: Spas and pools? R: No pool, each wing / floor will have a spa room. Q: Conference rooms? R: Hybrid spaces will be provided for conferences on each floor with a central conference room for staff training. Q: Will the apartment be attached to the new building? R: Intent is to eventually connect to existing campus. Cassia Chapel View September 11, 2023 Page 3 Q: Skilled and Memory Care? R: Setup to be able to change care levels to allow for future care. Q: Will there be volunteer activities? “Adopt a grandparent?” R: Yes, would like to include nearby schools to reach out to the community. Q: Input from current staff at Chapel View? R: Not yet, still high level. Assuming that with approval will go over with staff and core leaders. Support spaces and med rooms will need to be worked through. Pastor John – Cassia did reach out to talk about function and flow to coordinate with Church how it will connect to the site. Andrew / Cassia – We’ve been working with the City for a while. Q: Cassia owns a lot of property on 5th Ave, what’s their future? R: To stay, the City doesn’t want the residential area to change and for houses to go away. Q: Proposed facility fills the entire existing parking? R: Yes Q: Demo of existing church and trees? R: Church would most likely be first, then trees at a later time. Q: Plows make it difficult in the winter near the house on the hill near Minnetonka. Any word on fixing that? R: We will tell the City. Q: Plows and Rosewood? R: Possibly coordinate with Rosewood. Q: Entrance off Rosewood is bad, is there a traffic study? R: Keeping existing entrance, will need to check with City on traffic study. Q: What is the building exterior material? R: Working with the City to meet the new design standards. Proposed to have 65% of the 5th Street façade as face brick and 35% fiber cement board. - END OF MEETING MINUTES -